CAZyme Information: SPRG_07824-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07824-t26_1-p1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		58254.51	7.6995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583219:205553-207232(+)

Full Sequence      

MKLSLPIALAATAITTTAAAICKGIAPYSYTAAVQANAQFAPAIDELKKYSVATWYTDNG
GDSIDALLAACPYDTPVIIVYGLPGKDCASGWSGGGNNQNTDQYKAWAQKLASKVGNRKV
IYILEPDAIGLLSNNNCAVQNGYAGNLLAAKNILAANANAQIYADVAGWSTQANAVQALK
NLGKLSGIAINTSNYKSTNEMVQACQSYSSQTGGLHCIIDTSRNFNGSPQNEWCNARSAG
IGAPPTDQTGNSLVDYFLWLKVPGESDGQCHGQSSDAMIGPGAGQFFPDGFKSLWDQGYF
VSRGAAKIGQAPAPAPVPAPISSQCATKANWDYSGNDLYSFGVQGSTDDQVHKCCSSCQS
DSNCKAFTVAYNNCYLKHSTGSGGQSHNGGIAGTKSIGGASGGACGASEANTDYYGNDIT
RYAVSGDASSQASYCCDKCSATSGCAGYTINGGFCYMKSQMTNKFWSATAVSATRSGSAS
CGATEANTDYYGNDMSRFPVSGDANSQASYCCGKCTSTSGCAGFTINGGYCYIKSKLENK
FWSNSAVSGRRLSSRLRRV

Enzyme Prediction     

No EC number prediction in SPRG_07824-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	32	273	2.3e-54	0.9489795918367347

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	3.16e-38	37	270	1	287	Glycosyl hydrolases family 6.
227616	CelA1	2.78e-15	76	287	186	399	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
238533	APPLE_Factor_XI_like	9.93e-06	329	382	10	60	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
238533	APPLE_Factor_XI_like	2.18e-04	478	549	2	70	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
405052	PAN_4	2.95e-04	332	377	2	51	PAN domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55792.1|GH6	8.73e-287	1	558	1	559
AIG55492.1|GH6	3.19e-244	1	475	1	469
AIG55493.1|GH6	4.01e-191	1	475	1	393
AIG55776.1|CBM1|GH6	5.71e-162	1	314	1	313
AIG55789.1|CBM1|GH6	2.35e-153	17	310	14	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	1.64e-35	45	288	31	276	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
2BOE_X	2.92e-34	45	288	31	276	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
1UP0_A	6.96e-28	76	270	71	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	6.96e-28	76	270	71	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.05e-27	76	270	92	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	1.76e-33	45	288	62	307	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	2.07e-31	75	289	235	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26414|GUNA_THEBI	2.25e-29	45	268	65	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	5.47e-26	69	272	136	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P33682|GUN1_STRHA	9.43e-19	76	289	99	312	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004860	0.995107	CS pos: 20-21. Pr: 0.5548

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07824-t26_1-p1.