CAZyme Information: SPRG_07797-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07797-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	KK583219|CGC3	33490.46	7.5047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583219:137308-138264(+)

Full Sequence      

MQLLLSSALLIAASLRPVVGHGHLVDPVPAFTDKYGDPTKFAATLDGPTVLPGSTYGQGP
DWNTDEFTKHFKASSFKTLKAFLDAHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISS
HQGPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQWQVYKNC
VNLSGAAPGPGPNPSPNPSPNPSPSPSSGSPTMSPSPRPSPSPSANPAPSPSVNPNDPIQ
GWKQCGGAGYSGNTKCINGFQCTSLSLTYSQCMPNSSNKGQVLRFGQCGGVYYTGSTECT
PGDHCVPSNPWFSQCLPK

Enzyme Prediction     

No EC number prediction in SPRG_07797-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	10	231	3.5e-76	0.8979591836734694

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.53e-07	284	316	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.92e-06	284	311	1	28	Fungal cellulose binding domain.
197593	fCBD	1.51e-04	242	272	3	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO27087.1|AA17|CBM1	4.82e-181	1	286	1	286
EQC25603.1|AA17|CBM1	2.03e-157	1	285	1	285
KDO27085.1|AA17|CBM1	3.42e-150	1	284	1	300
AIG55787.1|AA17|CBM1	1.45e-112	21	285	63	362
AIG55788.1|AA17|CBM1	8.21e-96	19	280	20	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	4.20e-16	21	185	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

SPRG_07797-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999780	CS pos: 20-21. Pr: 0.9790

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07797-t26_1-p1.