CAZyme Information: SPRG_07795-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07795-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	KK583219|CGC7	34956.86	6.3568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583219:132553-133560(+)

Full Sequence      

MQLLLSSALLVAASLRSVVGHGHLVDPLPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGP
DWNTDQFTKHFKASSFKTLKAFLDAHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISS
HQGPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPEWQVYKNC
VNLSGAAPGPGPNPSPSPSPSSSPSPSSGPSPSPSPSSGPSPTPEYPSPSPSLRPSSRPS
ASPTPSPSVNPTDPIQGWKQCGGAGYSGNTKCVTGFQCTSLSMTYSQCMPHSSSTGQVPR
YGQCGGLYYTGSTECGKDDSCVASGPWFSQCLPGA

Enzyme Prediction     

No EC number prediction in SPRG_07795-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	10	244	5.7e-78	0.8938775510204081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.02e-05	299	332	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
197593	fCBD	4.88e-05	258	288	3	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.44e-04	300	327	1	28	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO27085.1|AA17|CBM1	4.99e-180	1	300	1	300
EQC25603.1|AA17|CBM1	1.59e-156	1	300	1	284
KDO27087.1|AA17|CBM1	1.26e-150	1	300	1	284
AIG55787.1|AA17|CBM1	8.80e-111	11	300	53	361
AIG55788.1|AA17|CBM1	6.89e-94	10	296	11	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	1.19e-20	21	185	1	172	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

SPRG_07795-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999773	CS pos: 20-21. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07795-t26_1-p1.