CAZyme Information: SPRG_07712-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07712-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		62071.88	5.6348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583220:305526-307234(-)

Full Sequence      

MKVPSVLLLALAAGHVAALDRKFYGLNYDVKPASGSGCKQPWQIQREVAAFKATTDAIRV
YATACTSDVLDAAAKNNMKVWVGLWSDLTYTHAFDGEFNNLKQLVQNKKIRNDNVAGIQV
GSEVLYRWYIQGKKDTADKTGVNWLIEQMKRVRAYLRDNKINIPVTVADVMDGYNLFPEL
YEAVDVVSVNQFSMWESVKAVDGISTLFGHWGDVTKQAKAAGKPVMISETGWSAGDDKDL
DFLAFAEKQSINYYYFSAIDLVHDADLIEKTFGMFDANANMKPDIVNVRVGSKPIATRLF
HGDKVLKVDPANWNALLIEAPASGLGKNLDNELWFYQPDSQTYYSKSSNQCLDAYGDNNN
ALSVHVYACSAENANQKWKMADDGHLTNLHLTNLNGANQCMDVDPTQQDKVAMWWCYDGP
NQKFAARPVAAEAITLGKSQTFLYEWYSDVMATSDVKYKDNTLWFYDPLNQTLKSKSSGK
CLDAYQTENDVAVHVYDCDNNNANQKWQYNDVTGQWMHASKLGLCLDTLADGKTHLDYCN
KSKASQQWPMGLAAN

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.30e-23	23	278	45	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	9.14e-17	344	507	6	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	5.67e-16	459	548	35	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	5.25e-15	303	424	10	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.60e-11	345	507	3	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56029.1|CBM13|GH17	0.0	1	552	1	561
AIG56030.1|CBM13|GH17	4.14e-228	1	553	1	576
AIG55846.1|CBM13|GH17	4.00e-199	1	553	1	567
AIG55545.1|CBM13|GH17	1.68e-155	1	553	1	571
AIG55960.1|CBM13|GH17	1.18e-147	1	552	1	571

PDB Hits     

SPRG_07712-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_07712-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999697	CS pos: 18-19. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07712-t26_1-p1.