CAZyme Information: SPRG_07534-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07534-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		38394.31	7.1332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583218:253567-254760(+)

Full Sequence      

MLRLTALVLLVLTAMASALDFRLYGLNYNSRQGADWDPKKCKSQDQIETDLSKIKRISDR
VRIYSLADCNQGPMVLAAAKKLGLKTWLGMWVTNEATFETEMKVLKTMVSSIDASVEGIH
VGSENLYRKDITPEQAISFVTTVKTFLTQQQIKIPVSVADIVDALVQYPAVLDAVDVIQA
NSFPFWEPANIDTAMINFKIKMDMLKKVAKGKEIQISETGWASGGVNANASTASPDNQAT
YLLNFYNYATEHKLKYYYFAAFDDAWKAVLPNMKNDVEAFFGLYDATGSLKPKIAALVQT
NSSIDPDNTTITVLPLTKTPMPVSPGAKPAPSSAATASIALATTVLAAALLA

Enzyme Prediction     

No EC number prediction in SPRG_07534-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	39	291	9.4e-25	0.9485530546623794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.50e-44	16	286	40	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.32e-09	25	291	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	9.54e-180	9	333	8	334
AIG55438.1|GH17	2.50e-164	1	333	1	345
AAM18482.1|GH17	4.82e-72	16	314	21	331
AIG55390.1|GH17	2.78e-67	16	332	20	351
AIG56392.1|GH17	1.07e-66	17	324	18	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.77e-44	24	294	38	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.35e-43	24	294	38	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	7.10e-24	43	292	405	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	7.10e-24	43	292	405	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	9.58e-24	43	292	405	675	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	1.67e-23	43	291	372	641	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|B8NTP7|BTGC_ASPFN	1.04e-22	43	292	402	672	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999777	CS pos: 18-19. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07534-t26_1-p1.