CAZyme Information: SPRG_06923-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06923-t26_1-p1
• CAZy Family: GH17|CBM13|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		33191.10	6.4744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583216:404094-405029(+)

Full Sequence      

MKSIYLGSLLAFLAVSVDAHGRMIAPPARGFMGRLDQFNFAPIDYDDDGLSAGGIGATSG
GRHGVCGDPYSQASPREHETGGKYGLFPKYRERAITSCYAPGAVIDIDIQITANHRGSFT
FGLCKLHGKNDKETEDCFVDLLQPNGNLQWPLPGGNKNFRLQYALPSNVECDGDAHCVLR
WVYTGGNNAGVGPDGQEHFWNCADIYISNACNGTNPFPTPVPTHQPSPDDGSGGYYPPAP
TTKAPKPTLVPTVTPRPTATTAPSTSTSPPTGAPGDKCNGQKNVCYWPASQQIVPYGKSD
CALFSSFVWCP

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	205	6.2e-52	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.66e-10	20	205	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
405911	TALPID3	0.007	216	256	947	981	Hedgehog signalling target. TALPID3 is a family of eukaryotic proteins that are targets for Hedgehog signalling. Mutations in this gene noticed first in chickens lead to multiple abnormalities of development.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO27652.1|AA15	2.07e-231	1	311	1	311
EQC31690.1|AA15	4.54e-210	1	311	1	311
EQC31691.1|AA15	7.90e-120	10	311	42	311
KDO27651.1|AA15	2.29e-117	1	311	1	303
EQC27234.1|AA15|CBM1	1.41e-109	8	252	7	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.92e-29	20	208	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

SPRG_06923-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999729	CS pos: 19-20. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in SPRG_06923-t26_1-p1.