CAZyme Information: SPRG_06922-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06922-t26_1-p1
• CAZy Family: GH17|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	KK583216|CGC1	32143.57	6.1233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583216:402447-403358(+)

Full Sequence      

MKLVALTLGLAAILHSAEPHGRMIKPAHRGWMGRLPQFSFVPIDYSDNGLNAGGIAATTS
GPHGVCGDPYAQAAPREHETGGIYGQFPTYGARAITGCYAPGAVVDIQIQVTANHMGYFT
FGLCKLNEKNDKETEECFQTLTQPGGEKRWPVPPGNDVFKMQYQLPSGVTCDGDSHCILR
WVYTGGNNWGAAGQEQFWNCADIYISNTCGSPSPVTPAPAVPTVAPVTPAPAVPTVAPVT
PAPAVPTVAPVTPAPVVPTVAPTPPPSEFCKGNTNVCFWPLTNQVVPYPKDDCIQQSAFV
WCP

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	203	2.1e-56	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	2.69e-13	20	203	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO27651.1|AA15	1.51e-204	1	303	1	303
EQC31691.1|AA15	1.14e-178	2	303	34	311
EQC31690.1|AA15	3.36e-119	1	303	1	311
KDO27652.1|AA15	1.28e-116	1	303	1	311
KDO27650.1|AA15	3.80e-111	1	210	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	7.41e-27	20	206	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

SPRG_06922-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999732	CS pos: 16-17. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in SPRG_06922-t26_1-p1.