CAZyme Information: SPRG_06895-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06895-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	KK583216|CGC2	89514.49	6.2348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583216:326755-329455(-)

Full Sequence      

MTWTVALAVAAAITASCAGDDSLRWGTYHSGLYFGVRSRTHPTHVSAGLLWTSANEDVSQ
LKHECSERDRLESYGWTKHNGRSFGQQTIRDRLNRMAIETTFLKPPAHDGSVATHSWASR
ITVSPLYAEKGLPELASLFFYIDVGCGDDQMGHACRDEVLQHLQWTIDEPSSCVEPMASS
DVTCIELSVRAEHAIDATFNFATRVQAHVTGDVPSLHFWGDAGVNVVNVKDRLVQLAART
PGSTDAAIVLPNDVDDESSIVVLQLRYDPRRASDVALHIVYNEATDDDTNVLQSTPVVVY
NDVIADYSATFGRQFEDTFGLAAKSSSAKHIALAEAAFSSLIGGIGYFYGSIYLEDHGRI
EETAPRPLFSAVPSRSFFPRGFLWDEGFHQLGIVHFDMDISMEVLSHWLHTMDEEGYMAR
EQIRGHLAQKRVPSEFLVQHASHANPPTLLLAIEKLAHLERARPWLLAHWPKLVTWFQWF
QTTQAGDVKHTFRWRGRHNDGRLMPNTLASGLDDYPRASSPSTDERHVDLLAWMAKAASV
LADVAAAIGHDGSTFSALHATYLEALDAHHWSNGLYLDYGLHSADGHFEDHIVIRCATVD
GAGIDATASARQLQRSDGSDVCPASHPRFLYPLGDGAGGLLKKQIFMPKTLRPQFVEHIG
YVSFFPVFLKLVPVDSPKLRPLLATLETHLLTPHGLRSLSPSDVYYARPNAPGDAPYWRG
AIWINLNYLALESFSFYAAHATDASTRAAFGDVYARLRTSVVDTIAAEYERTGFFHEQYN
DVSGKGQRCHPFTGWTALVTNILAERY

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	381	803	1.6e-23	0.356140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	299	805	5	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.55e-32	23	142	1	117	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
283786	GDE_C	4.44e-04	651	766	232	348	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
225942	GDB1	6.95e-04	651	734	479	548	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56123.1|GH63	0.0	10	807	8	797
AIG55648.1|GH63	0.0	2	807	3	797
UIZ28949.1|GH63	5.33e-222	24	807	65	896
CCA18876.1|GH63	2.45e-174	20	807	65	967
CAB1328239.1|GH63	9.12e-135	25	807	96	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MHF_A	1.57e-122	14	807	28	779	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4J5T_A	3.69e-78	20	805	12	802	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80UM7|MOGS_MOUSE	5.24e-123	14	807	83	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	3.00e-121	25	807	94	834	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	4.01e-117	14	807	85	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|Q84M89|GCS2_ARATH	1.46e-114	21	807	44	786	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1
sp|F4HTM3|GCS1_ARATH	4.71e-114	21	807	107	849	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000448	0.999525	CS pos: 17-18. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in SPRG_06895-t26_1-p1.