CAZyme Information: SPRG_06648-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06648-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	KK583211|CGC3	41626.41	8.4061

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583211:189019-190210(+)

Full Sequence      

MTWQAENARFRQRRPDWQCRTWSTLLQGVATAMNGSGPWARKPRWSSHKPTCLAMVSLFR
LALAACLMPDVFASLGLCSAVKPYSYSLAKVQFPHLKAALETVETQPIATWYTDRDIDSK
HQAALAVGNCPKGSRPTIVVYGLPNKDCQDHHSTDGANKTPEQYVQFLTDLSTTVGDNNV
VYILEPDAVGLLVGGSACATTFEYERNLINAVSLLGRNPQADIYIDIGFWVLGPANDAKI
ARVLSKLDPTGTRLKGISINTSNFRTTSELVQMCGNFSATARATANRTVTCVLDVSRNFA
GPDPTSQWCNPKGRGIGRPPTILSGERLIDYMLWIKPPGESDGNCNGGPTAGAFFLDGFV
ELWNNGYFVQAKGMNKVSAIAP

Enzyme Prediction     

No EC number prediction in SPRG_06648-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	94	346	5.8e-56	0.9251700680272109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	2.31e-39	94	350	2	292	Glycosyl hydrolases family 6.
227616	CelA1	2.44e-19	130	367	180	440	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55974.1|GH6	6.33e-168	59	382	7	329
UIZ23635.1|GH6	2.28e-86	61	377	8	322
CCA20052.1|GH6	2.25e-75	84	373	3	305
AIG55947.1|GH6	1.36e-71	81	380	22	312
CCA16954.1|GH6	3.97e-70	77	372	23	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	7.03e-32	133	365	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	7.03e-32	133	365	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	7.03e-32	133	365	68	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.09e-31	133	365	89	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	4.11e-28	94	362	24	282	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	3.00e-28	97	365	194	446	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26222|GUN2_THEFU	2.25e-26	94	362	55	313	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	1.69e-25	94	365	58	320	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P33682|GUN1_STRHA	3.26e-23	136	354	99	309	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2
sp|P13933|GUN1_STRSS	6.93e-22	101	347	105	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999534	0.000447

TMHMM  Annotations     

There is no transmembrane helices in SPRG_06648-t26_1-p1.