CAZyme Information: SPRG_06590-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06590-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975	KK583211|CGC2	109694.18	7.8292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583211:58871-61798(-)

Full Sequence      

MGVSATAARGQDETSNVISVHGFMYKQGKRTIKGPLHKSWRKRYFALEKTKMYYFQNDLE
CRQYFTTRNPDLVVGVVELKDALQLRPSGRLDLPTKGFEVHTKRRLWVLCPETDDEFHMW
FEAVERAIVATGAGNVIERNLPNVRTYVMKGLATYRLLYLLFLLAGLVELATLVLWFVVG
LQPCDQARPTDSCSLILSQTMDVLHCQSSPFNGVFSPPQFWLDFAGVGSVACFASPSVGQ
WISYLCLLLAECISFVLGGIYYLGMWKPVRRGAHYLDEFEPKLPDDQWPKVDIFICHYSE
PADETIDTLAACMNLQYPPHLLQIFILDDGYCKAKWTANDPVPTIELNKSVMEKAGDLRQ
EVAQYMYDRVGDPNEDMEVYAWRKLHSSANLPTPSRPRVVNRADCAVGSFRDDYRYSGLP
HVTFIGRVKPPTHYSKAGNINNACYNEGASGRYCIILDNDMQPHPKFILATLPFFFDSED
QQGKHKYMCCTPGCNLVARMCCASCNIAGVPDEQMSYCSKACFEKAMHTASALHRRQVNG
TVSATSSVCQDLSCVTCGGTVHKKTGLCKKCATHHTISMDDGLVTNGCYSDAVGSNHVAF
VQTPQYFRDCVQFQIGDPLGHRNATFYDAIQTGQDGYECASFAGTNAIFRREALDSIGGI
QYGSLTEDCYTGMQLCGLGWKGLYFRKDFEGEPSERIRLAEGLVPDNVASSLAQRKRWAK
GNFQIMLMNKKKNYFDAQWERPSCALPPKPTKHGFMRKVFYINSTIYPIGSICAVLFYYI
TLYFLFTGYAPIYLGGLRLLYGLVPKLLIQGMLSALSNRSVENNDVVRSQEAWFAYAFTH
TSAVFETFWWKLTGKEPTWFVTGSSSRGSITELPNVIVFFAHVLGCIWAIIRFFVTYNSL
QTSHGASLLVASLMMGLFIATKLGPSVRMSIQEYFGWSYHSLMDKGNFIGQSFIAFGLIF
ITLWVYIEKPSVSPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	593	795	3.9e-18	0.8274111675126904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.01e-44	289	726	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	1.17e-16	245	725	221	491	cellulose synthase catalytic subunit; Provisional
404513	Glyco_trans_2_3	8.24e-14	591	728	21	148	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133057	CESA_NdvC_like	1.73e-13	598	728	114	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	2.03e-13	598	792	168	344	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX56230.1|GT2	0.0	10	975	69	1033
ABP96903.1|GT2|2.4.1.12	0.0	13	975	67	1026
ADD84671.1|GT2	0.0	13	975	67	1026
ABP96911.1|GT2	0.0	13	975	67	1028
ABP96907.1|GT2	0.0	13	975	67	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	4.59e-15	601	728	260	381	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	4.96e-15	601	728	272	393	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	4.96e-15	601	728	273	394	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	7.24e-13	598	808	383	571	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	8.58e-28	420	843	584	882	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	5.21e-16	593	725	254	380	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	5.22e-16	593	725	256	382	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.54e-15	593	725	254	380	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	2.00e-14	598	764	259	419	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000001

TMHMM  Annotations     

Start	End
157	179
241	263
759	781
785	804
873	895
905	927
948	967