CAZyme Information: SPRG_06457-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06457-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1098		120984.73	6.4487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583210:212116-216037(-)

Full Sequence      

MTFAHSHATTDTPPWQAPLMRCDEYAAARAFDLARACYQALLADHRAAFDVQHAYARLLL
AQGADATAALEAATVLASPPYEQAHLDAFQALGMLYSDHGDLDRAAAVYTIPLLTTTNRS
DARLVPLLVNLGAVRLAQWSLDDARAITLEALALAPNSAAAYHNLGSIYHNLQDVVSAQP
CLQRATELDPANHHSFLGLALVACDVCDGVTSTKAFDTALALPSSHGSRDTIRLMQAMAE
LPRVTRSIHDVTDSRARFAMRLAALAEDVPLQLGDNPFQTIGCGSMGYFLIYQGGIDRRL
REQHAAIYRASMPSLSFVAPHVQAHRQSLNVHVAEGRRIRLGVVSGFFFEHTVALLLQGV
LTQLDRATFEIYLLRTTPKHDHVTQHLQACADHDIVLPRDVVAAQHVIAALALDIVLFSE
IGMDPSTYFLAFAQLGLRSVVFWGHAITSGISTVDYAITSPLFGTHQAHYTECLYAMPGL
TTAFYKPILSRDDVAADALVGELQKLQSTIYLVPQVLYKLHPALDALVRRILEAHDDAAV
VFLKGDRTALADIVYERWVKTMPPAVMARLFFLPLMSRQQFLHICAAADVVLDTFPVGGG
RTTLEILAVGTPIIVHEPRTTILQLSAAMYTLMDMPELIAYSDDDYVAKALAVGRNATFR
AALSQRILDRHDVLYNQSSVVDAWSTMLQSILATPPPLPGTCNVLPADADPVVYGVDLYL
QVLHEAFGFRVRASERHRTTEVAAAFGHAHALEPLYVAFIENVLHKGVARLEQPIVATVR
VPSPGLEPDVLAVDVRVGDDIWVAIFYAMWQHRVPTMLDTAYRIVDAWRAIAGQIDTTVA
WRAVRDRFPETNYVPTPVVARCVTLVLTTCKRLSLFLHTMASLRELMASPLVCATLVIDD
HSSEDDRRVMESTFPTVRFVYTRVKGHAVSMNTLLSLVSTRFVLYVEDDWVFVANATSLV
ADALEIFQSHWNDPHTRLAQVLLNDQESGWLQSTPSGSVSYKVLEFGVADPTHKMAHWPG
FSLNPAVWDLDRLKAQRLVFDTTSDVFERGFSLEVRRAGLHVAALRQRAAEHIGAPPGSN
ASAYVLNGLPRRFDLQAF

Enzyme Prediction     

No EC number prediction in SPRG_06457-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	69	685	1.3e-64	0.6283687943262412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.05e-26	335	667	256	588	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	3.36e-10	87	187	2	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.43e-09	127	202	3	78	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	6.71e-08	20	202	64	245	Tetratricopeptide (TPR) repeat [General function prediction only].
274350	PEP_TPR_lipo	7.92e-08	34	203	484	642	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEX22744.1|GT41	1.08e-60	246	681	257	680
BAI76932.1|GT41	9.56e-60	151	683	127	642
BAZ61948.1|GT41	1.14e-55	156	689	368	882
BAZ15802.1|GT41	1.14e-55	156	689	368	882
BAP54338.1|GT41	2.61e-55	238	681	141	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	2.20e-12	337	667	161	489	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96301|SPY_ARATH	3.63e-06	337	669	481	816	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996923	0.003119

TMHMM  Annotations     

There is no transmembrane helices in SPRG_06457-t26_1-p1.