CAZyme Information: SPRG_06052-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_06052-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1110	KK583208|CGC1	123485.51	6.4237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583208:36538-39941(-)

Full Sequence      

MVELGMLVSGIVGVLGGFSAALAGWSPLSLGARPLFVLSQGLSVFAIVFMAIYSPLYYVT
STSEVTALAIAAGVGAGMGLVAAFLTVLSPYFLTAATGLILAPYLLVLDESVGHLFEGQS
SFAKQEFVVGFGLLWFVLFLSHSKTSDTECHRFKYVLFSAITGGWLFSDGIFRLVFSNQA
PLSKLMFGIMGIPYEGVVYSLSEGITDSNKLYVMVIWAGMAILGSLNQLSMRWGLLCYNK
VGAHVGMTSIHEDTMELPSGAAASAPFMHERTRLVCENCFATVPAGTAFCTECGEAMPSD
DHVPNVSISQAQMPSLAMAADGTTPERWQQIPNRAYLSTTSFVDPKKMTENNTESRSIRF
MDAGDKPYGASMSGRPNHYEPSFRSFAMSTYSIANRAAEPVETPNIRKYKMSGGAAFHLI
YFLSAIAGIVWLAFLITFYPRETPCSVSQPQLSCSLIEQSVKTAFNCTPSTNPQNINIQT
QEPNCIKATPGGVWFCYVIFVGSEYLNFFLGLLYNFSMWRPIRRGARYLNDFKPALPKEQ
WPTVDVFLCHYSEPVVDSMKTLKNILAMQYPPELLHVWICDDGYTRSVWDANNHFKVTVN
TKNIEQCGDIRGDVARMMHERVVGPVQDDASLKAWRRQHSSVRELKKDGIKGVQRRDCAV
GSLSDDYDYRDRGLPRVTFVGRMKPEEHHAKAGNINNVLFNEGADGKYILILDNDMKPHP
KFLLAVLPFFFSEGEAVDGTGRQYSDDISWNQVAYVQTPQYFEDSPQITEMGDPCGHKNT
IFFDAVQCGRDGFDSAAFAGTNAVFRRQAFDSIGGIQYGTQTEDAFTGNILHGAGWDSVY
FRKDFEGEPKDRIRLCEGAIPETVATSLGQRKRWAMGAVQILLMKGDSEVDPDWRPPRVP
APDPKPSLVFPRKLFFYDSVFYPFGSIPALCYVFIAIYYLNTGSAPIYTPGQNLMYTFLP
VMLIRWMLNLLANRTVDSNDVWRAQQTWFSYSFITALAIGEAVRWRLTGVISAWTNTVVG
LMRFFNYENATSPWNYVSAMFFGFWIMSNLYPMAKMSISEYAGWDHTTATFTASVFGSLL
LVGIVVFVQVWQTTYSLNMLTAQGLSQTTT

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	4.77e-56	542	882	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	7.68e-29	533	886	248	502	cellulose synthase catalytic subunit; Provisional
224136	BcsA	3.35e-21	493	1034	9	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	2.18e-20	690	884	69	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
215121	PLN02189	6.35e-17	492	1088	281	1025	cellulose synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX56231.1|GT2|2.4.1.12	0.0	1	1106	1	1129
AFB20350.1|GT2	0.0	1	1104	1	1133
AFB20349.1|GT2	0.0	1	1108	1	1131
AFB20357.1|GT2	0.0	7	1109	8	1143
AIK98134.1|GT2	0.0	7	1110	8	1139

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.46e-26	529	963	258	571	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	7.79e-24	530	885	116	382	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.13e-24	530	885	128	394	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.15e-24	530	885	129	395	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7D5K_A	2.83e-10	492	809	281	619	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	9.56e-40	661	1002	568	888	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q8Z291|BCSA_SALTI	3.14e-26	529	963	258	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	3.14e-26	529	963	258	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|P37653|BCSA_ECOLI	1.24e-25	529	963	258	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	1.63e-25	529	963	258	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000000

TMHMM  Annotations     

Start	End
7	26
36	58
65	87
125	142
155	177
211	230
417	439
494	516
920	939
954	973
1032	1054
1069	1091