CAZyme Information: SPRG_05579-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_05579-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		47133.58	6.9732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583205:289176-290582(+)

Full Sequence      

MRWPLAVGVGGLLVISLLSCQRLDSLLYTIQDRAVHHASAAAHYARYQLYPSLEQVLPYA
ESFLFPTVVARHGASYSCIKFQYTGTGGCPSQINDVLSYVYTPNKTEACDTVIHTGIYGV
PGYCELRDDATHETIRTLYTSCGSLTGRQFTCALAAQYASYGHDASTFIYALNTSYFARR
GIVFSVHPGALASAYASIAHLRATNCSLPIEVWHRPDELPAENAILQALETTFRVHVRPI
FHPLATRFYSKIYAVLHSAFESVLLLDCDNFAVQNPTYLFSTHAFQSTGAVFWPDYWRPG
HTCFNIDGYSRLWDLLGINFVDMFEQESGQVLINKTMSEPALHVLAFFALHEPRFLTDFG
MVYGDKDLFRLAWLKAAAPFHMIARPQAASASWTAPTGLIFVATAWSSTTRTATSSSCTE
IRSS

Enzyme Prediction     

No EC number prediction in SPRG_05579-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	180	395	1.5e-44	0.9356060606060606

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	2.33e-35	180	381	2	241	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28362.1|GT71	1.18e-69	95	388	684	987
CCA20955.1|GT71	2.20e-69	119	388	158	436
UIZ24059.1|GT71	5.78e-68	74	386	139	481
UIZ29182.1|GT71	2.46e-65	119	381	94	360
CCA25989.1|GT71	3.56e-65	107	390	119	427

PDB Hits     

SPRG_05579-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	1.27e-10	177	385	243	502	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.07e-10	194	366	164	356	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	2.07e-10	194	366	164	356	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q59YS7|MNN14_CANAL	1.17e-08	149	372	246	499	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|Q5AD72|MNN24_CANAL	2.58e-07	197	383	310	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000520	0.999497	CS pos: 19-20. Pr: 0.9562

TMHMM  Annotations     

There is no transmembrane helices in SPRG_05579-t26_1-p1.