CAZyme Information: SPRG_05353-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_05353-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		41763.08	8.9058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583203:548009-549193(-)

Full Sequence      

MKLSYLPLALLAFALDAVSGASTPGVAAGVTGGGNAAPVYPKNTNELKAYLQDAVPRVIV
LNKTFDFRGTEGRKSETGCRPDYTRECIAKKNGFKSQDVILQAGGMANTGGCTNGTPVQV
SYDVAGTKNPLVVMGAKTIRGEGQKGVIVGKGLWLRGDNIILQNVHVTNLNPQYVWGGDA
IYLNGKPDGSAQQKIWIDHVKISKVGRQMLTTDGAGANSITVSNCDFDGEAEWSATCDGR
HYWTNIFISNLKMSYLNNVIRKTSGRAPKINSANGKYSVQVHTANNYWHDNSGHSFEVDE
AYVLSEGNFFAATASPNLAEPNGWIMSTTNANKGSCKAALGRDCVPDAFVNSGDFVDHGA
SAVPAKMKGLATTFAAKPAARLTLSSANFGVGNL

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	120	311	1.3e-71	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.93e-32	117	313	1	189	Amb_all domain.
226384	PelB	2.21e-12	113	310	70	273	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	4.02e-08	99	310	2	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56253.1|PL1_4	1.90e-202	1	394	1	394
AIG55603.1|PL1_4	1.12e-199	8	394	10	396
AIG55680.1|PL1_4	1.05e-180	8	343	10	345
ACR19247.1|PL1_4|4.2.2.10	3.11e-140	9	394	10	398
ACR19251.1|PL1_4	3.11e-140	9	394	10	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	5.85e-67	25	392	9	358	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.28e-65	18	394	3	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.33e-62	18	394	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.44e-81	25	359	29	345	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	9.12e-81	9	394	12	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	9.12e-81	9	394	12	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A2R6A1|PELF_ASPNC	1.62e-77	9	394	12	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.62e-77	9	394	12	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999801	CS pos: 20-21. Pr: 0.9833

TMHMM  Annotations     

There is no transmembrane helices in SPRG_05353-t26_1-p1.