CAZyme Information: SPRG_05209-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_05209-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		61652.49	6.7494

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583203:213530-215194(+)

Full Sequence      

MRITSILASLAAAATSVMALDRQLYALNYASCPDDTNMPLDLDKLKDITHTVRMYSMDEG
CMTRLYWHAGWRNMKIWLGIWSEADAKIDSFDGEFQRLKNLVEKGMVNNNNVVGIQVASE
AIYRYYIQGQHDFADKGPINRIIQHYKDVKAYLRSKNLFFPVVIADIMDSYKYFPELFAN
TDVVSVNAFAMWQNKTAAEGVPTLYNDFHGIWNSARALGKPVVLSETGWATGGTADVVAE
TSPEAQALYTKEFISFAEQQNVNYYYFSSFDGNRDPEIERHFGLFDNTRTMKPLIASLTV
GAAPTAVRLHSDASVLKAGSYKQGETFGKLSISAPAKGLTDRLDNEIWFYDQAGSGWLKS
RSTNACLQGNGKGQFVSVARCDAAKASQRWSFNGNGAQNGDLCLTKSLKLTSCSNNNGLK
KVDMGSQELRIAVAGSDLKLTEYYGALSVRSAPMAGAIPETQLWYYDPMLQTIKNKANQN
SCLDAWEFKDYGGVHVYNCDATNDNQQWQYNDKTGQIMHARKLGLCLSSDASNGNVYLLS
CDVQNAGQRFQMNL

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	32	292	1.8e-22	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.55e-25	31	289	58	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	4.82e-15	461	550	37	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	4.67e-11	472	553	2	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.43e-09	472	553	4	85	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.57e-08	360	508	3	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56445.1|CBM13|GH17	5.01e-315	1	554	1	550
AIG55423.1|CBM13|GH17	4.77e-307	1	554	1	554
AIG55614.1|CBM13|GH17	6.80e-297	1	540	1	542
AIG56029.1|CBM13|GH17	1.80e-132	1	550	1	557
AIG56030.1|CBM13|GH17	2.37e-120	5	554	7	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.86e-25	25	293	42	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.07e-24	25	293	42	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

SPRG_05209-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000383	0.999597	CS pos: 19-20. Pr: 0.9622

TMHMM  Annotations     

There is no transmembrane helices in SPRG_05209-t26_1-p1.