CAZyme Information: SPRG_04956-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_04956-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42211.82	7.7025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583204:492897-494000(-)

Full Sequence      

MARRGVNLGGWLVLERWITPDSPIYTESGLTGDVVEHGQYQIMKALGHARGDPLMERHWA
TFYTEADFRDIKAAGLDMVRIPVGYWLLNDAPATKARRSANGTTTDDASVLAPGSLAYLD
KAFRWARKHQLKVLVGVHAAMGSQNGEQHSAASSIRKIQWFDKAGNIDNTLDLVEFLVDR
YQYHAAFLGIGLLNEPQHGNDPTKFAQLKQYYKDAHRIIRRELGSDCIITFSTAFNEKPE
FDAEWRVFLKHDPNVWAEVHKYYIWGYEGQNFDQIKAYVKGHEAKWIKEWTGAPLFFGEW
SIANHEDTFVLNDAQKTQYANLVTQVFKPAHWTYWTWKFWADPNAYVAWNMKTLFQRKIM
TATMLGN

Enzyme Prediction     

No EC number prediction in SPRG_04956-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	57	314	5.4e-48	0.7953795379537953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.35e-24	4	353	19	378	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.40e-10	64	337	26	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56426.1|GH5	1.95e-247	4	367	27	390
AIG55747.1|GH5	1.06e-181	4	366	27	384
UJR33211.1|GH5	1.07e-85	4	360	42	386
UIZ29723.1|GH5	1.70e-72	4	356	13	356
AAM18484.1|GH5	5.68e-72	4	360	21	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	5.03e-34	4	303	10	290	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.05e-33	4	303	15	295	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.85e-33	4	303	10	290	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.04e-33	4	303	16	296	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	2.83e-33	4	303	16	296	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q875R9|EXG_LACK1	8.11e-40	4	316	49	338	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|Q96V64|EXG_BLUGR	2.42e-38	4	300	38	318	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q12628|EXG_KLULA	1.31e-36	4	312	37	329	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|O93983|EXG2_WICAO	6.23e-34	4	312	43	329	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q12626|EXG_PICAN	1.34e-33	5	274	51	300	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_04956-t26_1-p1.