CAZyme Information: SPRG_04685-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_04685-t26_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	KK583200|CGC2	80536.29	7.6396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583200:326038-328510(-)

Full Sequence      

MVVRSTAAFLLVAAVAHSTAGLDIGDNTQPTKSGVPTWVDVNTPAEVYNKTSSRGDAWQL
VMSDEFELDGRNFSAGYDHLWTALDIPDGVNRAIEIYTPKNALTENGSFHIRIDSGEVDI
AYYNVWANIPGWTKKKMYYSAAMVQTWNKFCIQGGFVEVAAKLPGALNKESMNPHVQGKL
WTPQGMKPIKPADKIPDIRFYPTWPGIWLMGNLGRALFAASTNKMWPWTYNECTELSRKN
QRISACNRTLALGFTRTKAAARRRSTFSKAIAPGMPDEYRLTTPVLALEASTNVDPQGRK
GVGHVFCYYDKNCLTPGANMADVSTAAFASRGHKSWYHGLRYAANDRCSPDPKLVQQYES
VAKAQNGTIIDNQWDIKTISSGKDLHADLSLIDGKGPLHWGINYKGTCFPIANGYKGGFL
CDRDSMNPKCDNPRKAHEQETMMMEPFEYQMDAISSNWDINYEAYTTYYKYQLEWVMGDD
GYVRWALDGAPIFEIPASSMTNPPQGGKEPNPKKIMIEEPSYILFNVAMASAWGATPPNW
QVGPCRGNASIPTPGSDEFKMSNNICDSFPMYLSIDYIRVWQDASRMSYGCDPATHPTKE
FIKAHITNYTDPLNLDLPVAGGASCKSADDCTVTTSLTGACVKSRCECMHGWTGPRCTKY
DLKDASFGPSMALSVGLVAFAVAASVGAFVLRQKQRRTLEKTLEVFRDQRKSQLSARQSD
IIDNTP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	64	244	8.4e-56	0.40797546012269936

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	4.01e-51	18	612	76	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	4.74e-40	60	582	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	4.54e-06	453	581	145	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	7.97e-06	43	233	34	156	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	3.25e-04	63	212	2	103	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55703.1|GH16_2	0.0	26	671	21	700
UIZ28152.1|GH16	9.17e-194	28	682	17	678
UIZ27810.1|GH16	6.70e-193	8	691	44	727
UIZ28149.1|GH16	8.36e-193	4	694	2	703
UIZ28151.1|GH16	4.86e-186	27	680	28	690

PDB Hits     

SPRG_04685-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	1.46e-29	37	645	357	767	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	1.17e-27	39	645	307	715	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87023|KRE6_CANAX	5.06e-27	39	609	332	717	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	2.97e-23	39	233	219	366	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87024|SKN1_CANAX	3.98e-23	39	609	336	714	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999748	CS pos: 21-22. Pr: 0.8883

TMHMM  Annotations     

Start	End
669	691