CAZyme Information: SPRG_03990-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_03990-t26_1-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1386		155335.27	6.3871

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583198:482138-487851(-)

Full Sequence      

MVGFFRGSISPSKVAVEASATTKAAGKPSPTKPSELATPKTPGEATMEAANLDMFGADSD
ESDDEAALERYDRKEMDKVSEATQEEYNKRNVALLLSKMSPEELFKKFDEDQSGLISADE
FLAMLPQLNITVSKPKGLRIFRACDKDGSGEIDLEEFKMALFAVDPTSGNTLQFTPSSLL
SPKDAFSLFDENGSGQIDELEFADVVEYFNINADDAKQEKLFRKYDKDRSGYIDLEEFRA
MWLQCIDVEAELRARKIEIPKYATRAKLMQMLEVVLLEEEHNEAQVLLEAKWYHHWQLEK
IRRSTLAAKATLRAQDELAAALDAAGQVYVLGTGQYDQFTSAPATRDPLLYDGYKSVSAI
WEARVQPTYVPPVVKLKPLDPTRAKDSTSTAVSETKTLPKTERKPSPEKIPFVRRRPENA
GWVDSSPPKLDRLLWKPKPQEATETPDESSVSDFETDDELLTKFLDDRQYVRSLRFQSIH
PMPNTGWLWGRQVTHATITDSIAYAMTASGQIYCWGGQNKWWKGLAAETRNTHGNDDDDD
DGFDDEMALRRQHEKDIAAARQLTARSELQKMASPKHVAAAVALEVEVQRQNAAELEYRQ
EKEVKAYEKYKRVVVYFGHWEPPPSASTRVVFLHQVLLPKISIAEVKASLMNRGFTIDRV
TKLEMIDLFSDCLDIEHELCSEEQRRVFMESDFQIQEAEKVQLKPKQAAQLVLDKAKLLE
DYALYRQQQARLHELRIEEEKRANLDFALRREAAFEASVAHHRIQLEDVVPEYTPRHTSL
VVDLNGVTSRGPPLHANRGAPAAWRLAAGESYACVVTHAGALYTWGVGIHGRLGHGKNLE
GVVNSDADHPTRVLALQSVFVKEVACAFDHSAAISLGIGALDDKYEQFALYPMLVKIPNQ
RRIRQVSCGRAHTGAVSTLGELFMWGCANGGRLGFGERVLDQVVVPTYVKALAHVRVAQV
SCGNTHSALCTEICSEIAASVETISGGDIYVCGSAGPLMQYTPSWSLLQSIRGTPIRQVA
CGFGHTAAVSMDGELYTWGQNAKACTGHPEERRVVPEPELLRAFHTAPFNLALHKRCRQS
SVLNEQSANCAVNGNRSGRLHACTHTQYDDCPWWEVDLGQPCVISRIQVWNRTDEPIDIS
HPRDEYTRRLFPFWILVSEMPLPDGSGKEVLKTGRDLSNEAKEFTQNQRLTQWILPTSES
VGRYVRIHVRGRAYMHLAEVEVFGVYHALNYVGQVSSVHCAKNVTLVVMRPIAKSTVLHD
HYIKAVQADPDNAMILRQYEAYVKCFHLYGRGEPLSKVPCRLCRATRKCEVCEFFETTPS
TDMPVTPLGGKLGLKEAAEVIQSREPPRPAYVPFVPPARESITDKISKVIQLSPPKLRLR
QSATNS

Enzyme Prediction     

No EC number prediction in SPRG_03990-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1079	1220	9e-21	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227455	FRQ1	1.15e-19	103	243	24	155	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
227511	ATS1	3.28e-17	806	1061	109	388	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
238008	EFh	6.58e-16	102	161	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
227511	ATS1	8.60e-15	806	1062	181	440	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
238008	EFh	1.34e-14	183	242	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UAB81195.1|CBM47	1.64e-15	1068	1224	36	172
QQX77088.1|CBM47	9.13e-15	1068	1224	46	182
UCA56570.1|CBM47	9.13e-15	1068	1224	46	182
ACD95713.1|CBM47	1.99e-13	1070	1224	131	272
QOX79078.1|CBM47	1.99e-13	1070	1224	131	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XZM_A	6.10e-16	805	1047	116	353	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
6XZN_A	6.10e-16	805	1047	116	353	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZN_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
3KCI_A	7.12e-16	809	1070	115	372	The third RLD domain of HERC2 [Homo sapiens]
4O2W_A	8.11e-16	810	1047	135	368	Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_B Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_C Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens],4O2W_D Crystal structure of the third RCC1-like domain of HERC1 [Homo sapiens]
4DNV_A	1.06e-15	805	1047	113	350	Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_B Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_C Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNV_D Crystal structure of the W285F mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9VR91|HERC2_DROME	4.86e-19	809	1041	3081	3310	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|Q4U2R1|HERC2_MOUSE	6.20e-17	809	1041	3056	3285	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
sp|O95714|HERC2_HUMAN	6.20e-17	809	1041	3055	3284	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
sp|Q7ZZC8|NEK9_XENLA	3.48e-16	804	1041	351	606	Serine/threonine-protein kinase Nek9 OS=Xenopus laevis OX=8355 GN=nek9 PE=2 SV=1
sp|Q8IVU3|HERC6_HUMAN	6.30e-16	786	1052	6	277	Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPRG_03990-t26_1-p1.