CAZyme Information: SPRG_03384-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_03384-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35426.14	7.5853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583196:700504-701469(-)

Full Sequence      

MFRTAFARATRAAPRAFARSLSVSSARRPAFASPSTALVGAFFVTTAASISLLHAKEAKK
PDLDQIRKEIVDLMDDDALIGPTFVRLAWHSSGSYSKHDHSGGSKGGTIRHKPESAHGGN
AGLDIAVARLEAIKARHPEITFADLIIFSGIAAIAEMGGPDVGFRIGRKDVQAGELVTPD
DRLPNADKGSKPSTISHIRDVFYRMGFNDREIVALVGAHAVGRCYPSRSGYTGPWTRAET
TFSNEYFRELIENKWTIKKWKGPEQYEDPTGDLMMLPSDMAFLWDPEFKKYVELYAKDED
VFFADFAKAFQKLTENGVAFE

Enzyme Prediction     

No EC number prediction in SPRG_03384-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	64	317	2e-57	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	3.67e-133	54	321	5	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.03e-77	82	317	32	243	L-ascorbate peroxidase
173823	plant_peroxidase_like	1.73e-66	64	315	1	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
178467	PLN02879	2.19e-60	56	319	10	248	L-ascorbate peroxidase
223453	KatG	4.98e-59	54	320	60	419	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	7.38e-128	37	320	45	329
BDA47129.1|AA2	6.05e-95	57	320	82	348
QKY15243.1|AA2	8.11e-91	50	320	96	364
QRD85779.1|AA2	5.61e-89	40	321	68	349
QMW29426.1|AA2	5.61e-89	40	321	68	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	1.09e-72	62	317	7	258	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
4GED_A	1.45e-72	62	317	7	258	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	1.54e-72	62	317	7	258	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.59e-72	62	317	8	259	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	5.09e-71	62	317	8	259	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	1.81e-88	49	320	85	352	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	1.52e-86	76	321	131	371	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	2.66e-83	40	320	61	341	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	5.31e-83	59	320	83	344	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q6URB0|CCPR_CRYNH	7.50e-82	49	318	90	361	Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997579	0.002422

TMHMM  Annotations     

There is no transmembrane helices in SPRG_03384-t26_1-p1.