CAZyme Information: SPRG_03034-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_03034-t26_1-p1
• CAZy Family: CBM20|CBM47
• CAZyme Description: lipid-A-disaccharide synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		46803.49	9.4545

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583195:802439-804058(-)

Full Sequence      

MRPTAKRVVYIVAGEASGDAIGAKLIRALQTKEPSVTFRGVGGPQMTEQGRFASLFPMKE
LSFMGLTEVLPKIWSTLGHLRAVVKDIHACAPDAVVTIDSKGFTFRVLRILSAQGLLYHA
LSHVEKIDVASVRRKAAVVHYVAPSTWAYTHKFKHMEATANGLSRLMDHMLVLLPFEAPL
FQPRTMTRPVVTFVGHPALEDFGDVHHLFEMTVPTLDASSDDTALLPSSPWLPYDAYAAR
KTQAILATLAAERAQPKAATWTIVALVGSRENEVLQTISLVRQAIELYSAQARNAPIHVV
FPTISAVAPLVHAHLADWSMPFTVHVTDDASKKRSLFQQSHVAIAVSGTVVLEAALAGLP
TVVIYRANRVTELLARFLARVQHVSLPNIMSSRTLMPEVLFSECTPINIAAALTYCAVAL
NAWSNVVLS

Enzyme Prediction     

No EC number prediction in SPRG_03034-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	414	1.6e-83	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	2.10e-87	9	413	4	335	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	1.20e-79	9	413	4	338	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	4.66e-69	9	415	1	337	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
167141	lpxB	1.91e-30	10	413	230	566	lipid-A-disaccharide synthase; Reviewed
237606	PRK14089	2.42e-15	55	409	42	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH57271.1|GT19	7.70e-57	8	414	5	338
APH62330.1|GT19	1.15e-56	2	414	25	364
APH54743.1|GT19	1.15e-56	2	414	25	364
APH52168.1|GT19	2.12e-56	8	414	5	338
ABI62339.1|GT19	2.12e-56	8	414	5	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.61e-30	9	413	9	341	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.75e-29	9	413	9	341	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0BS63|LPXB_GRABC	3.77e-57	8	414	5	338	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
sp|B6IST7|LPXB_RHOCS	8.12e-53	8	412	5	339	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
sp|Q5FUA3|LPXB_GLUOX	8.44e-52	3	410	25	359	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
sp|Q5LSU1|LPXB_RUEPO	4.97e-49	9	413	19	359	Lipid-A-disaccharide synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=lpxB PE=3 SV=1
sp|F4IF99|LPXB_ARATH	4.74e-48	9	413	42	399	Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_03034-t26_1-p1.