CAZyme Information: SPRG_02554-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_02554-t26_1-p1
• CAZy Family: CBM13|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	KK583194|CGC1	88529.10	8.3231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583194:602263-604869(+)

Full Sequence      

MGVPTLSKASVFRFARQPRHHGVKTRLLRSRSKTLMLGGQSTAETAQYASCNPNGDETSS
NSLKPLKLKDMSTDDLLRHAEQLDMHLAKIYIESQKTKALAPIVTKSIGLPQQLWEDAGV
APPYHSAAEFQDLRYTAVRTADPIAFSADGYSLRVHTLGKSIKVFITVTMYNEPASQLQA
TLTGLAGGIDYLCHQYGYDFWQEVAVVVVADGRSKTHHSVLPYLESFGAFEKNLLAQAIA
ASKDTHLIFALKEHNAGKLHSHLWFFNAFSEQVDPTYTALVDVGTVPAESSVYRLIRSME
RNPQIGGVAGEIAVDDPDFFNPVIAAQHFEYKIANIMDASLQSVFGFIGVLPGAFSAYRY
EAIRPINGVGPLAEYFKSLTASKKELGLCVGNMYLAEDRILCFEILARKNCDWTMHYVKD
AIAHTDVPETLVDLIKQRRRWLNGSFFAGLFAIWNFGRVWTQSAHSLPRKCAFSLQFLYL
AFQNVMNWFLLSNLFLTFFYILSLALYYKSIELLHVVLGTYFVLVGSLIVFALGNKPGHR
TAIYYRVSSYIMGTIMLCVTCISLYALLGNVQFVDPRSDLPSCSVSNYELEAGAFFSLGI
IFVCAFMHGEFGIVRSTVQYFFMLPTFVNVLGIYAYSNLHDLSWGTKGIETSAGHNGLPT
SKFGSVKDMVALHLNATSTTDVVSEADKRKGVVAAEHEDVDNRFRVFRSLLLLTWLLTNG
CWLYYATSFISCSCYLKYLSYIVAVFNTFRFLGGLLFLSFRMARGALHCCRQGVKKTRPL
RCGNPQAGDDCSPV

Enzyme Prediction     

No EC number prediction in SPRG_02554-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	280	526	1.8e-20	0.45351043643263755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.07e-75	166	448	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	2.23e-37	170	299	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	2.14e-29	162	578	54	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	5.44e-20	168	368	3	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
367353	Chitin_synth_2	4.36e-16	273	443	197	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA49151.2|GT2	0.0	23	769	20	781
ADE62521.1|GT2	3.18e-275	75	774	197	914
AAC49743.1|GT2|2.4.1.16	2.17e-226	78	712	157	789
ADE62520.1|GT2	2.24e-152	86	753	166	841
ARC77249.1|GT2	3.84e-142	96	755	166	844

PDB Hits     

SPRG_02554-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	3.85e-227	78	712	157	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P30595|CHS2_RHIOL	2.08e-113	123	765	145	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P87073|CHS1_PHYB8	2.99e-111	121	765	126	841	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	4.59e-110	129	765	149	858	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30597|CHS1_SCHPO	6.80e-109	120	765	145	858	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
441	460
486	508
513	535
547	569
592	614
706	728
738	760