CAZyme Information: SPRG_02132-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_02132-t26_1-p1
• CAZy Family: CBM13|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764		82283.92	6.6654

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583193:736757-739337(+)

Full Sequence      

MTAWSDTQSATLAAVVDTFTGPLTVSDASRLVTEHLATLRDHAAPHQTQTRDGLMALAQV
DPMELDVLESFKTLLNDLPKDKVRDISRVLDLLATGWGTMLLTGSRMAPFHELDRLEREA
AMNTLARSRLSIVRSLFLAFKALTVLPTYATAATVDGAPSPFWAPLEYPGVPAKDPEMEP
AWVPRFEDIEALAKEAGDGNPIELETDVVVVGSGAGGGVVAAELAQAGYRVLVLEKGVYY
NPVDDPFTELESLRQKFENGCIVIPDDGSVLFLAGATWGGGTAVNWSASFRLPYNVRQEW
ATQHRLPYFASPAYEAAINAVWARAGVSDSHFCHSGANQVLEDGATALGMGVAKIAQNTN
GAAHDCGFCNLGCPTSEKQSSAVTWLKDAQDANAKFIQGCHVDRVTYSHEKIATGVEATV
LNGSVKLIVKASTVIAAAGSLHTPALLLRSGLTNPNIGKHLRIHPVSSVHGFVPSKLIQP
WAGAIMTSVCTQLADLHGDGYGVRLEVPSSILGMLSTILPWRSNADHKRLVMQYPRTASF
IALVRDCDTVSRVTIDADGRPRISVSLGSKDALSVQEGLIAGAKILLAQGAVEVNTTHFD
LPPLQLRSKDDLANPIECATTQNWFALVRARGVVQNRIGLFNAHQMGSCRMSASPDDGAV
NPDGETWDVKGLYVADASLFPTSSGVNPMMTTFAMGYSVAQFIKANLAAEKSHPTGKLRK
VWPATPWWQRVFRDPTAFAVVALLWLLGGKHFWTTRLRALLGRP

Enzyme Prediction     

No EC number prediction in SPRG_02132-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	204	710	2e-51	0.511326860841424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	9.48e-59	267	466	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.02e-29	223	706	25	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.02e-22	550	697	4	141	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	2.84e-05	380	470	201	287	choline dehydrogenase; Validated
235000	PRK02106	4.87e-04	644	682	473	510	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	3.05e-110	62	711	95	738
VBB74103.1|AA3_2	1.81e-10	207	705	75	626
QPG97990.1|AA3_2	4.56e-08	205	703	63	639
BCS10571.1|AA3_2	7.83e-08	203	703	65	636
QQK43083.1|AA3_2	1.74e-07	191	700	18	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	3.49e-07	200	718	8	541	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	3.49e-07	200	718	8	541	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.49e-07	200	718	8	541	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	4.23e-98	86	707	96	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	4.55e-95	89	700	95	737	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9LW56|FAO3_ARATH	6.27e-93	89	713	90	746	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|O65709|FAO4A_ARATH	1.55e-91	202	699	220	714	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q94BP3|FAO4B_ARATH	3.70e-88	192	707	225	742	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_02132-t26_1-p1.