CAZyme Information: SPRG_01737-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_01737-t26_1-p1
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	KK583192|CGC4	37338.56	5.4925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583192:970501-971496(+)

Full Sequence      

MVRVLSALSLSFVFAHALKTTAPPANATATPDLDENAAVPDLARLAALNETTVAEPEQKA
VPEITTVPFGLVTASGAAIYEYYGNVYAGAASNSANEQWNYGIFSHQIISYSNNQCLDAY
KDSDSGEYRVHMYVCDDNNRNQAWTIDTVHHRIKHRTHPNLCLDVDPTQNNKVQVWTCHD
DAPNQRIMVTEDAVKLHTFNGRYLVNGQGMPLFVALWGRPIEWVVSNVDLTWRWRSRYFT
SDECLDAYEPWNGGAVHLWPCDSTNGNQKWRFDAATGQLRHATHTGFCLDLSTPDINMPY
GTRPYLWACNTPANDLQKFTFESLTFRDSYF

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	89	208	3.5e-16	0.6436170212765957
CBM13	221	323	9.4e-16	0.5106382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.51e-19	107	270	4	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.76e-18	152	319	4	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	9.32e-18	152	321	2	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.31e-17	92	186	33	125	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.04e-15	108	272	1	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55540.1|CBM13	1.89e-97	62	326	341	598
AIG56318.1|CBM13	4.97e-68	42	293	319	552
AIG56282.1|CBM13	7.56e-54	69	293	344	556
AIG56230.1|CBM13|GH17	3.51e-49	57	321	238	506
AIG55595.1|CBM13|GH17	8.43e-49	67	319	301	553

PDB Hits     

SPRG_01737-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_01737-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.060111	0.939860	CS pos: 27-28. Pr: 0.5798

TMHMM  Annotations     

There is no transmembrane helices in SPRG_01737-t26_1-p1.