CAZyme Information: SPRG_00621-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_00621-t26_1-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		80542.15	8.2794

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583190:251012-253252(-)

Full Sequence      

MVFVVALAALLAPLVAAYHPSHGSGALGHPISFDSPKGDNSSSSSSRPDPVAVAANGSDP
LASMYRTSTDQSWLAPPRNLHASIKDMPIPTNRWWGNLISAGKDNAELRAWANPYAVAMH
RDAIGVSYPPSSRVFGGSSGNGKAPRYYLHGIGNDLFVSATELKASGATPFQIRKWDDLG
VTVTASYGGKSVESSFVSGMAYVSAKYHGLTPRLTTTHGITRVNGQAVTAGASFASASKL
ALTMGNGMVWVLYASSPLSWSLTSSTELTATGPATGTTVRLALASKGSDGSDYDAYADCI
VHGGSVTTTTSSYAFKWATEGACSKGLLHFGLQHHIDTLSPSSATRLHATGLALESTTRG
KLFALVTKESWRFDEKDLVPASFFPRQSPSKARVPSVLKALQADIAAPWNLAIGGSYYFN
GKAAQKYASLCLIASDKAVVGDDTALLRSCQKKLETVLAPFIDNSWTYPLVYDSVYKGIV
SSEGFVKKDLNADFGNTMYNDHHYHYGYWIATAAIANKVHPSWLRLGDLNARAATLVRDV
ANADSGDKAFPTFRMFDWYKGHSYSHGVTALADGKDQESSSEDINFHYGMALFGSVTKNS
PMAGLGQLLLTLNARVVKTYFLMDSSNVVQPIEMRPNKVLGIFFDNKADYATWFSAEKYC
IHGIQMIPTTPVTEYVRTKKFVQEEWDEVLAPLPLIAKKQVDNAWASLLYLNYASVNADV
ALEMLQKVPMDDGLTRAWALYLASAM

Enzyme Prediction     

No EC number prediction in SPRG_00621-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	80	741	5.5e-174	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.39e-146	401	740	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.99e-143	70	746	72	755	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.34e-43	76	378	2	310	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56018.1|GH81	0.0	7	745	7	754
AIG55599.1|GH81	0.0	9	745	6	753
AIG56513.1|GH81	5.00e-288	64	745	85	768
UIZ20868.1|GH81	3.66e-221	49	745	79	791
UIZ20872.1|GH81	2.08e-220	49	745	79	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.09e-101	89	744	41	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.68e-101	89	744	66	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.28e-96	89	744	41	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.92e-26	51	737	12	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.42e-22	76	734	35	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.96e-104	75	746	23	702	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.38e-85	59	745	200	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.79e-84	77	746	70	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.89e-77	88	744	460	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	3.18e-77	88	745	110	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999727	CS pos: 17-18. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in SPRG_00621-t26_1-p1.