CAZyme Information: SPRG_00546-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_00546-t26_1-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	KK583190|CGC11	49282.50	6.6332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583190:64346-65922(+)

Full Sequence      

MAPAERDPLIAYPSERARSRWTARFIAYAAAALVLAGCGLAASLHPAPSPLHDVVSSALA
LDASLPRRPAHCPHIAPHERVVLFWQSEVGGCEQIPDGVTHVLWGFAQVEAGEVIPRFQT
PDALLTSCVQALRARCIYSLGVVGGANNNVGMASIRDPPRFVRSVMSLVDKFQFDGIDID
DETNYLEAGYSSRAIVSYMTALRNAFRPLNLLLTYDAYMMEANPHCYKGMRCFARGVERL
VDWVNVMAYNIDRDPKLAMPIYEAAVHQTFPQWQRHVSKDKITVGMCTGSGCAWGPGPSP
DVVDAYIRYAKGAGGIMIYAGSADIDQGFVTTKSVVARLHPQSPTQLAVATTAPPAIVST
PAPTTVTPAPTTVTPVPTTVTPAPTTVTPVPTTVTPVPTTVTMAPTPELSTVTPAPTEPG
VRPDAICGSCFNCFYEPIKGCFDGWSEAQCKSLSFTWCG

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	93	295	1.9e-20	0.6081081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	5.43e-17	96	251	21	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	7.62e-12	96	286	20	220	Glycosyl hydrolases family 18.
119362	GH18_3CO4_chitinase	4.66e-09	99	324	23	242	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
214753	Glyco_18	4.92e-09	96	319	23	272	Glyco_18 domain.
119350	GH18_chitinase_D-like	1.20e-07	122	331	59	292	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

SPRG_00546-t26_1-p1 has no CAZyme hit.

PDB Hits     

SPRG_00546-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_00546-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.733616	0.266385

TMHMM  Annotations     

Start	End
21	43