CAZyme Information: SPRG_00317-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_00317-t26_1-p1
• CAZy Family: AA15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	KK583189|CGC4	44193.07	6.4427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583189:807537-808800(-)

Full Sequence      

MARRLILCLLVSLAPSLVHGHVQTAIRSGAATARGVNLGGWLVLERWMTSYAELWKKVPE
SIKDHGEHAAMAAVGRATADPLVKMHRDEWITEDDIKEIASFGMNMVRVPVGWWIYEKPE
ETDWQHFTPGGLEYLDRLMNEWAIKYNVAVLLDIHATKGSQNGREHGAAPVFGATNFTDY
AVNVDRTIETGRFLVDRYKHEPAFLGLQLLNEPEWWQEKNQGTDRTKLKQFYKDLYATTR
ALCGDCVVVIAPFLSEQDSSHAEWGTLFPDSSPVNNWIDWHKYLKWGFEGQNMDQITSSG
VDNIEKDLKAWRGNNRVFMGEWSLGHPDSAHAQFQDDAKVALLGQRLLNALDAAKAGWTF
WSWKADYGTRYGDGWNMRSLLRDKLLKL

Enzyme Prediction     

No EC number prediction in SPRG_00317-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	367	2.6e-40	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.61e-18	34	226	19	207	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.24e-16	86	366	20	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55478.1|GH5	2.50e-208	20	388	13	375
AIG56251.1|GH5	1.63e-199	18	388	15	403
AIG56483.1|GH5	1.11e-139	18	388	15	394
AIG55998.1|GH5	6.75e-133	21	388	20	388
AIG55999.1|GH5	6.89e-128	18	388	17	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.47e-27	34	380	10	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PC8_A	3.00e-27	34	380	16	378	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	4.06e-27	34	380	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	4.06e-27	34	380	15	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1CZ1_A	5.22e-27	34	380	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	1.98e-34	34	373	52	389	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q96V64|EXG_BLUGR	6.88e-34	23	386	27	403	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	5.69e-33	34	368	43	371	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	2.08e-32	34	368	43	371	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	1.12e-31	34	373	43	379	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000287	0.999686	CS pos: 20-21. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in SPRG_00317-t26_1-p1.