CAZyme Information: SPRG_00039-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_00039-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	KK583189|CGC3	63032.37	6.2522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583189:76716-78473(+)

Full Sequence      

MAAFALGALALAAAVSAAPIDDRDALRKELSAWKASDAGVYAAANGLLREHLDGASEDAE
LAVFAASKAAAAALQKAHPLAEFSVDTPFALMTSDEFASWVTAARPARNASALPASSEGI
SVATNTVDWKKSGCVAPVKDQGGCGSCYAFLSVGATESAYCLAHHQRRTLFSEQQTVSCG
PGLGCRGGYLDDSLKWIASNGLCTSDSYPYTNGQSATAHPCQSTCQKLPMPFSNIAVVAG
EDTLEKALNTQPVAVEVATGGDTWRLYKGGIITGGCSGPLTHGVLAVGYGAAGSPYYNLK
NSWGPNWGEGGYVRLQRGVGGPGMCGVASFMAYPVLRKPQFYLVTSHGHLITEFYSDLYA
SSSTKSGAMNEEWSYDFTTRQIIVHSNYECLDAYNDGGTYRVHTYKCDASNPNQRWSMDN
YRVQHLHFPNLCLDVDPNQNHKVQVWSCAENAPNQRITGVWDEKVTLRSFNQLTMGVDGD
NVQFNGGVEWGVSVSDDTWRARTGDWTKCLDAYDARNGGAVHLYPCDGSNLNQKWRYDPA
TKQLKHLTHAGFCLDMGSEAGTRAHLYWCNTAIVLQLFDRATSLL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
239068	Peptidase_C1A	3.17e-65	127	334	4	210	Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues.
395062	Peptidase_C1	2.91e-62	126	335	4	212	Papain family cysteine protease.
214761	Pept_C1	9.01e-51	126	334	4	175	Papain family cysteine protease.
240310	PTZ00200	1.88e-45	128	338	239	447	cysteine proteinase; Provisional
185513	PTZ00203	5.51e-41	78	319	76	326	cathepsin L protease; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55540.1|CBM13	3.37e-211	11	573	11	585
AIG56318.1|CBM13	2.24e-185	11	564	6	558
AIG56282.1|CBM13	9.52e-183	7	582	9	580
AIG55595.1|CBM13|GH17	3.44e-51	343	570	305	544
AIG56230.1|CBM13|GH17	1.35e-44	341	571	250	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CQD_A	4.90e-42	125	337	5	218	The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale [Zingiber officinale],1CQD_B The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale [Zingiber officinale],1CQD_C The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale [Zingiber officinale],1CQD_D The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale [Zingiber officinale]
4YYQ_A	1.16e-41	126	335	4	215	Ficin A [Ficus carica],4YYQ_B Ficin A [Ficus carica]
1S4V_A	6.03e-41	126	338	5	221	The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm [Ricinus communis],1S4V_B The 2.0 A crystal structure of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm [Ricinus communis]
3P5W_A	1.72e-40	127	335	5	216	Actinidin from Actinidia arguta planch (Sarusashi) [Actinidia arguta]
2FO5_A	2.06e-40	126	340	7	230	Crystal structure of recombinant barley cysteine endoprotease B isoform 2 (EP-B2) in complex with leupeptin [Hordeum vulgare],2FO5_B Crystal structure of recombinant barley cysteine endoprotease B isoform 2 (EP-B2) in complex with leupeptin [Hordeum vulgare],2FO5_C Crystal structure of recombinant barley cysteine endoprotease B isoform 2 (EP-B2) in complex with leupeptin [Hordeum vulgare],2FO5_D Crystal structure of recombinant barley cysteine endoprotease B isoform 2 (EP-B2) in complex with leupeptin [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7XWK5|SAG39_ORYSJ	4.40e-43	6	334	12	337	Senescence-specific cysteine protease SAG39 OS=Oryza sativa subsp. japonica OX=39947 GN=SAG39 PE=2 SV=2
sp|Q7XR52|CYSP1_ORYSJ	5.49e-43	89	340	119	379	Cysteine protease 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CP1 PE=2 SV=2
sp|A2XQE8|SAG39_ORYSI	6.09e-43	6	334	12	337	Senescence-specific cysteine protease SAG39 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_14861 PE=3 SV=1
sp|O65493|XCP1_ARATH	1.23e-42	89	338	99	355	Cysteine protease XCP1 OS=Arabidopsis thaliana OX=3702 GN=XCP1 PE=1 SV=1
sp|P25777|ORYB_ORYSJ	1.77e-42	89	334	105	356	Oryzain beta chain OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0670200 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999633	CS pos: 17-18. Pr: 0.9754

TMHMM  Annotations     

There is no transmembrane helices in SPRG_00039-t26_1-p1.