CAZyme Information: SPCC970.02.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPCC970.02.1-p1
• CAZy Family: GT76
• CAZyme Description: mannan endo-1,6-alpha-mannosidase Dcw1 (predicted)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	Spom972h_chrIII|CGC1	49135.08	4.2119

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrIII:512043-513540(-)

Full Sequence      

MSLTIFISLATILFSFAEAISVDLNDTSSVDLATSLVADGLLNYYAGQHKGGTIGMFLPP
AYWWEAGAAWNGLLNRYIATGNSTYNELVKTSMLYQSGEDSDYMPSNYTTSEGNDDQAFW
GLTVISAAEANFSNPAADEPQWLELAQAVFNQQVTRWDTDHCNGGLRWQITEFNSGYNYK
NTVSNGAFFQLAARLARFTDNDTYAEWANVAYDWSQRIGFIQEDYTVFDGSSIKDNCSSI
EITQWTYNIGLYMAGAAYMYNYTNSTVWKTRVEGFANKTAKTFFFKDIMFEPVCEIALSC
NYDQTSFKGFLTRFMVYTAQMAPFTAPLLEPLLISTAKAAAGACCGGYDGVTCGVQWWWN
NDTWDGLYGLGEQMSALEAIQAPLLLKSLQVFKASNGGSSTGDPNAGLYTAPVSFANKNF
ENLRKHWMLLGFFLLVPTLVLY

Enzyme Prediction     

No EC number prediction in SPCC970.02.1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	27	388	1.5e-105	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.26e-169	29	377	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	3.83e-08	143	266	113	228	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA20695.1|GH76	0.0	1	442	1	442
NP_587853.1|GH76	0.0	1	442	1	442
ANB11543.1|GH76	2.07e-146	19	425	23	428
QHS74548.1|GH76	4.02e-145	7	425	7	426
AJS43315.1|GH76	9.25e-144	7	425	7	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	9.82e-96	30	408	37	426	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	0.0	1	442	1	442	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	4.67e-144	7	425	7	426	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.54e-136	9	416	3	414	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.03e-135	18	410	20	413	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q9P6I3|YHG7_SCHPO	5.71e-133	29	407	29	402	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000280	0.999676	CS pos: 19-20. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in SPCC970.02.1-p1.