CAZyme Information: SPCC1919.03c.1-p1

Basic Information

• Species: Schizosaccharomyces pombe
• Lineage: Ascomycota; Schizosaccharomycetes; ; Schizosaccharomycetaceae; Schizosaccharomyces; Schizosaccharomyces pombe
• CAZyme ID: SPCC1919.03c.1-p1
• CAZy Family: GT8
• CAZyme Description: serine/threonine protein kinase AMPK (beta) regulatory subunit Amk2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		32969.64	6.3015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Spombe972h	6995	284812	1857	5138

• Gene Location: location=Spom972h_chrIII:2207736-2208999(-)

Full Sequence      

MGNVQSQEGETRAHAVPSQDATTTPDNANNVPKEPRAQSMISIAADDLNQEGEMSDDNQQ
EGGNNRTSQNGTSGSSGHTKRRSQTSGKKTHQPYSGPCVPTIIRWRGGGEVVYVTGSFSR
WKKKIQLLKSEDYTVLLQLRPGTQRFKFLVDGIWCCSSDFPTATDAEGNLYNYLEVEANE
KLGASIDERLSQVHTDLPMEEKSESEQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCI
LNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFDV

Enzyme Prediction     

No EC number prediction in SPCC1919.03c.1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.00e-41	99	180	1	83	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
214973	AMPKBI	2.83e-30	202	294	1	98	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
199889	E_set_AMPKbeta_like_N	1.11e-28	100	176	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
398422	AMPKBI	2.03e-23	237	294	11	68	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
199878	E_set	3.06e-04	100	154	1	60	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA22634.1|CBM48	8.93e-215	1	298	1	298
BAA13800.1|CBM48	1.20e-214	1	298	9	306
QSL66752.1|CBM48	1.15e-54	99	298	109	311
CDS09494.1|CBM48	4.24e-52	99	294	227	434
EGX43158.1|CBM48	5.78e-44	99	294	174	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OOX_B	1.89e-62	203	298	2	97	Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP [Schizosaccharomyces pombe],2OOX_D Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with AMP [Schizosaccharomyces pombe],2OOY_B Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP [Schizosaccharomyces pombe],2OOY_D Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP [Schizosaccharomyces pombe],2QR1_B Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP [Schizosaccharomyces pombe],2QR1_D Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP [Schizosaccharomyces pombe],2QRC_B Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP [Schizosaccharomyces pombe],2QRC_D Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with ADP and AMP [Schizosaccharomyces pombe],2QRD_B Crystal Structure of the Adenylate Sensor from AMP-activated Protein Kinase in complex with ADP and ATP [Schizosaccharomyces pombe],2QRD_D Crystal Structure of the Adenylate Sensor from AMP-activated Protein Kinase in complex with ADP and ATP [Schizosaccharomyces pombe],2QRE_B Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP) [Schizosaccharomyces pombe],2QRE_D Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP) [Schizosaccharomyces pombe]
4REW_B	1.52e-37	100	294	3	195	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
7JHG_B	3.10e-37	100	294	4	196	Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JHH_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7JIJ_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens],7M74_B Chain B, 5'-AMP-activated protein kinase subunit beta-2 [Homo sapiens]
4RER_B	8.41e-37	100	294	3	195	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]
6B2E_B	5.90e-36	100	294	78	270	Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78789|AAKB_SCHPO	1.59e-215	1	298	1	298	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|Q9QZH4|AAKB2_RAT	2.77e-36	100	294	77	269	5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Prkab2 PE=1 SV=1
sp|O43741|AAKB2_HUMAN	5.60e-36	100	294	78	270	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1
sp|Q6PAM0|AAKB2_MOUSE	2.11e-35	100	294	77	269	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1
sp|Q9R078|AAKB1_MOUSE	2.33e-33	100	294	79	268	5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus OX=10090 GN=Prkab1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000003

TMHMM  Annotations     

There is no transmembrane helices in SPCC1919.03c.1-p1.