CAZyme Information: SPBR_08405-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_08405-t41_1-p1
• CAZy Family: GT34
• CAZyme Description: mannan polymerase II complex MNN10 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	AWTV01000011|CGC19	53771.33	9.0421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000011:1136133-1137694(-)

Full Sequence      

MSLSRSPSPSPDGGWSSPGLNINGSGRSSPSKSYGDSNGGSTLHSRNSGASKYPSFATQN
QGFFTRHMRQLSSSLPRFNANTPTSRASSYSDKDKPRGRWEFSKSSLLGRVKLFFAHMGR
TTRIRWAIVLALLAAIYIFYHSPLVYYWRRTAWLGGGEKFVIILAANVGGGVMEWKGARE
WAIERDSTRNKKRYAARWGYDLEIVDMSTKKRYAHEWRESWEKVDFIRQAMRKYPKAEWF
WWLDLNTFVMEPSYSLQDHIFNDLEKHIYRDINEYNPLNLTHPFNDVYLDDVSRSTVGNG
QADSVNFILSQDCSGFNLGSFFVRKSEWTDRLLDVWWDPVSYEQKHMEWEHKEQDALEQL
YTAQPWIRQHMAFLPQRMINSFPEGACSENGNNTRFHYEQNDRDFLVNMAGCEWGRDCWG
EMYNYRELSYYLNRSLWERFKEDLLCAAWFKLTGQKVKF

Enzyme Prediction     

No EC number prediction in SPBR_08405-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	158	420	5.7e-87	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	9.13e-82	158	418	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.16e-05	221	336	182	265	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.14e-04	221	346	183	278	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP69563.1|GT34	1.78e-245	1	458	1	460
CDP23580.1|GT34	1.78e-245	1	458	1	460
VBB72694.1|GT34	1.78e-245	1	458	1	460
UQC79993.1|GT34	1.42e-237	1	458	335	790
AEO65857.1|GT34	5.08e-237	1	459	1	457

PDB Hits     

SPBR_08405-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	2.62e-104	147	440	107	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.42e-85	158	429	73	334	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	1.14e-26	185	412	125	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.06e-23	189	428	129	349	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	7.71e-20	158	412	85	311	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
126	148