CAZyme Information: SPBR_07365-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_07365-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: glycosyl hydrolase family 5 protein/cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	AWTV01000009|CGC4	46216.97	4.7053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000009:4753414-4754670(-)

Full Sequence      

MKLFRVLLTALNLAELSAAQIVIPLHSSSRWILDSNNNRVKLRCINWAGHMEVNLPEGLH
KQPISFLADWTRDQGFNCVRLTYSIEHALNPNTLVSDAFTNAATAAGVPLTNMTAMYNDA
VAVNPFMGEATTTTRDVYGAIIDALWERGVVTLLDNHVSKASWCCDLTDGNGWWDTAFGY
IAANSQYFHTAQWLQGLQAMASWAYTNHPGVVAMSLRNELRQLLFQDTNNGDDWYDLVSE
AGSLVHQANPNVLVVVGGISSATDLSSVRISRMLNTTAWLGKHVWEWHSYSFTVTFPRIL
PCALLKDLYGGFAGFVLTQGKDYTGPLLLSEFGVGQTGGTIDGGLSSDDSTYLSCLTEYM
ESNDSDWVVWALQGSYYVRGGQTDYDETWGLLNHDWSALRNPQFPGLLGGMWNMTQGP

Enzyme Prediction     

No EC number prediction in SPBR_07365-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	32	372	9.6e-104	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.43e-05	140	372	69	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69593.1|GH5_11	7.34e-196	2	418	6	420
AEO57401.1|GH5_11	1.04e-180	1	418	2	427
QGA14302.1|GH5_11	1.14e-175	20	418	17	409
UQC77964.1|GH5_11	4.53e-172	23	418	24	416
QKX58257.1|GH5_11	2.19e-170	11	418	6	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	1.41e-15	26	399	7	339	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	1.41e-15	26	399	7	339	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C0HLA0|GH5FP_CHAOB	2.32e-77	7	404	13	387	Glycosyl hydrolase 5 family protein OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
sp|P54583|GUN1_ACIC1	1.58e-14	26	399	48	380	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999714	CS pos: 19-20. Pr: 0.9089

TMHMM  Annotations     

There is no transmembrane helices in SPBR_07365-t41_1-p1.