CAZyme Information: SPBR_07247-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_07247-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: exoglucanase 3 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396		42076.21	5.2536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000009:629028-630440(+)

Full Sequence      

MKFQYSALLALAASAYAAPPTQSVKEVARQASAGCASAVTLDASTNPFKKYTLHANTFYR
KEVEAAVAAITDTSLAASAAKVADVGSFLWIDSIANIAKVEPAIADVPCDHILGLVIYDL
PGRDCAAKASNGELKVGEVDKYKSDYIDPIVKILKAHPNTAFALLIEPDSLPNLVTNSDL
DTCKKSADGYETGVAYALKSLNLPNVVMYIDAGHGGWLGWDANLKPGAQGLAKVYKAAGS
PKQVRGFSTNTAGWNAWDQSPGEFSTASDAKYNKCQNEKTYVDTFAPLLKSAGMPNHAII
DTGRNAVTGLRKEWGDWCNVNGAGFGVRPTADTGDELADAFVWIKPGGESDGTSDSSATR
YDSFCGKDDAYKPSPEAGTWNQAYFEALLKNAKPAF

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	65	357	2.8e-86	0.95578231292517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	3.48e-152	72	360	1	293	Glycosyl hydrolases family 6.
227616	CelA1	5.03e-44	46	395	24	442	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59280.1|GH6	1.09e-232	1	396	1	395
ACH15009.1|GH6|3.2.1.91	1.09e-232	1	396	1	395
AAQ38151.1|GH6|3.2.1.91	1.09e-232	1	396	1	395
QBZ63529.1|GH6	3.00e-223	1	396	1	395
AEO64572.1|GH6	7.30e-222	4	396	5	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4I5R_A	1.22e-114	46	396	2	357	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]
4I5U_A	1.97e-113	46	396	2	357	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]
4A05_A	1.28e-111	40	396	1	364	Chain A, Cellobiohydrolase Family 6 [Thermochaetoides thermophila]
3VOG_A	2.05e-107	46	394	8	360	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
1BVW_A	2.70e-107	46	396	2	360	Cellobiohydrolase Ii (Cel6a) From Humicola Insolens [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AE04|CEL6C_PODAN	4.44e-212	6	395	7	396	1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6C PE=1 SV=1
sp|Q0CFP1|CBHC_ASPTN	1.34e-114	39	396	105	468	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1
sp|P49075|GUX3_AGABI	5.98e-114	46	395	90	437	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|A2QYR9|CBHC_ASPNC	1.15e-113	40	396	94	459	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|A1DJQ7|CBHC_NEOFI	1.75e-113	44	396	92	450	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000376	0.999637	CS pos: 17-18. Pr: 0.9686

TMHMM  Annotations     

There is no transmembrane helices in SPBR_07247-t41_1-p1.