CAZyme Information: SPBR_06872-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_06872-t41_1-p1
• CAZy Family: GT76
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666	AWTV01000009|CGC31	71119.40	5.9402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000009:1237882-1239882(-)

Full Sequence      

MFATSSPDLLKTVMLGNGTGFRASSHGVFTWVLQNPDSGASFTVLQQVNTPSMSNISTSV
TLTTSAGTFTVPGVELYGRQSKILVTDYALGQHNKSALLYSSVDIATSEYFGHETALILY
LKEGQIGEFAFRGDSNLTYTVFGSLKVTAITRQPRGSSSLQQAFTYTQSAGASAVLFSND
VLVYILDQATAWRFWAPRDGDNSFDVAGSSRVFILGPYLVRSARIDWAAGVLYVLGDSDS
ATTLEAFVGSGGGKIINTVNWNGKTLPATRTPYGSYRAAISGGRDRVSNGNVTLPKLTEW
HAADSLPETQSDYDDSRWTVCNHTTTHGPVPPVTPPVLFASDYGFYVGAKVYRGRFLSTG
PTPSAVNITASGGQGFGWTAWVNGHLLGGSPGVAGQATTSAVLRLPTDVINIEKGRDNVL
TVLVDYHGHDETSTRNGLNNPRGLLGAKLLFDESDKDRNSRATEASSGFTTWKIMGNAGG
SANIDPVRGPMNEGGLYGERLGWHLPGFSAATDGKFSKSSPTDGIKDAGVQFYVTEFMLA
VPTDLDVPLGIELAAPVGTIARVQLWINGYQYGKYVPHIGPQTRFPVPPGILNMHGNNTL
ALSLWAMTSAGARLDKVALVGYSDGGDGNNEDIMSAYETTFFANAEQWAASSASLQLPWT
DRSEFA

Enzyme Prediction     

No EC number prediction in SPBR_06872-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402180	BetaGal_dom2	3.42e-57	9	193	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	3.37e-37	8	194	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	3.73e-35	497	608	1	109	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	1.57e-23	313	430	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404273	BetaGal_dom3	9.08e-18	207	276	1	64	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78589.1|GH35	3.28e-233	1	666	369	982
BCS07304.1|GH35	4.90e-228	1	666	270	886
BCR94715.1|GH35	1.36e-226	1	666	377	993
APA12177.1|GH35	1.69e-222	1	622	371	956
ATZ49456.1|GH35	6.75e-217	1	622	371	959

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	1.15e-92	4	620	370	944	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	6.48e-88	2	619	368	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	2.55e-85	2	619	388	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	2.55e-85	2	619	388	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	3.87e-82	2	619	388	977	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7EZS5|BGALC_SCLS1	3.00e-223	1	622	371	956	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|A2QL84|BGALC_ASPNC	4.00e-187	1	636	372	978	Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacC PE=3 SV=1
sp|A1DM65|BGALC_NEOFI	5.56e-181	1	666	375	983	Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacC PE=3 SV=1
sp|Q4WNE4|BGALC_ASPFU	7.84e-181	1	666	375	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacC PE=3 SV=1
sp|B0Y752|BGALC_ASPFC	7.84e-181	1	666	375	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000004

TMHMM  Annotations     

There is no transmembrane helices in SPBR_06872-t41_1-p1.