CAZyme Information: SPBR_06539-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_06539-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901	AWTV01000009|CGC21	98488.68	4.9544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000009:1679247-1682264(+)

Full Sequence      

MPAMQPPIAGEIDSESIIDSITSPMTSGGPSITPDTEISPPNSPFTPSGHLNNARQTARK
KLETLTLDEKACNPQQNILVSLLTAADFWRTKSIPAKGIPSAKTTDGPNGARGGIFVGGT
KAALFPCGISLAATWNKDILYRVGQHLGDETKARSANILLAPTVCLHRHPLGGRNFESFS
EDPLLTGKLASQYIRGLQQRGVAAAIKHFVANEQETERNNLNSVVSERALRELYLRPFEI
AVREASPWAVMSSYNLINGAHADMNRHTLGDILRGEWGFDGTVISDWDGVNSTAESIKAG
CDIEFPFSTKWRFEKVLKAIEDGSLTVADVDRAAENALTLVTRVKGDDLSEEAPEREDDR
AETRELIREAGVQGLTLLKNETSILPIDQRTTKLAVIGPNANRAIAGGGGSASLNPYYTT
IPLESIRRAVKEAGGQNEVAYAVGCHTNKWLPVASPFCSNRDGSQGVTIDWFSGDKFEGS
PVVTEKRKNTDLFLWDSAPVSRVGPHWSAIATTYLTPISTGKHTISFMSVGPGRLYVDGK
EVMDLWDWTEEGEAMFDGSIDYLVDVDMQAGQAVELKVRMTNELRPISKQKKTGATHKYG
GCRIGFKEQDQVDYVQEAVDAARAADVAVVIVGIDAEWESEGYDRQTMDLPVDGNQDRLI
EAVLAANPNTVVVNQSGSPVAMPWADKVPAILQAWYQGQEASNALADVLFGKKNPSGKLP
CTFPRRLEDAPAYHNWPGENLEVIYGEGLYIGYRHYERAKIAPLFPFGHGLSYTQFEYGR
PSINKKVLSPESGSTVEITLAISNIGDVEGAETVQVYVHDEKSRLARPEKELVAFEKVSL
EPSETQHITLSLDKHAVGYYDTAIGQWIAEEGRFNVLIGASSADIRRSISFSVEESFTWV
F

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	93	305	1.4e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.62e-84	125	898	120	763	beta-glucosidase BglX.
224389	BglX	1.59e-73	87	432	48	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.98e-53	375	753	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.39e-47	24	853	18	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.08e-43	98	340	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB72333.1|GH3	0.0	14	901	17	908
AEO66128.1|GH3	0.0	1	901	1	888
AEO53892.1|GH3	0.0	12	901	10	884
CDP23238.1|GH3	0.0	14	886	17	895
CAP69216.1|GH3	0.0	14	886	17	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.80e-183	62	899	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.97e-179	62	899	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.24e-150	59	885	6	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.49e-121	65	885	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.16e-110	91	895	43	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.32e-227	62	894	15	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	8.14e-206	62	890	6	807	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.22e-202	55	900	3	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.24e-201	55	900	3	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	3.38e-201	60	900	8	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPBR_06539-t41_1-p1.