CAZyme Information: SPBR_05664-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_05664-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	AWTV01000004|CGC6	82670.43	4.1855

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000004:1142673-1145024(+)

Full Sequence      

MKTASPSLAWLALLGYLVATIQAAFWMEEVPHNGLAPYAEDGYVVFRNVLDYGAKGDGVT
DDSAAINAAIADGNRCDKGCQSSTITPAVIYFPAGTYVLSTSILPAYMTQLIGDATNLPT
LKAASNFVGLGLIDGDPYYSGPDPNWLSTNLFYRQIRNFVLDTTAIDATKLAYGVHWPTA
QATSLQNVRFVMPRTKGVAHIGLFIESGSGGFMTDLSFDGGAIGASLGNQQFTMRNLAFD
SCVTAINQLWDWGWTYYGLDIKNCDVGLNVSSGGSSAQSVGSITVFDSVFTSVSVAIVSA
YVPNTSQPETAGSIILENIVANQVPVIVQTPDGNLLTGGVAVTVAAWGQGHQYIPDGPTP
LQGGFNGNLRPTSLLASGNPVASAAGVPGSYYARAKPQYEDLLACNFLSARAAGAKGDGV
TDDTAVLQELIDSATLTGKVVYLDYGLYVVTNTLTVPPGARIVGEAYPIILAGGDSFFKS
DSNPRPLLQVGAYSGEQGTVELSDFVLATQGAQAGAILIQWNLDASASSDLGGIWDVHTR
IGGFMGSELQVAGCLKNPQSSTVNSNCIGAFMSMHVTKSAAAVYAENVWLWTADHDMDDW
NNTQISIYSGRGLYVESSSGPVWLVGTGSEHHTLYQYQVANARDVFMGQIQSETPYFQPN
PLATTPFEANATYNDPDFSACDASDTTCALAWGLRVLDSDTVLVYGAGLYSFFSNYGQTC
IAGRSCQARITSIEGSSPAVNIYNLNTIGVASMLDRDGASLASAADNKNVYPDTIALFQS
QAG

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	22	779	3e-276	0.9851351351351352

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.72e-91	46	269	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.17e-09	407	476	1	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	1.05e-04	48	98	84	125	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64347.1|GH55	0.0	33	780	27	763
EAA31173.2|GH55	1.41e-313	24	780	19	766
AEO59077.1|GH55	2.47e-313	1	780	1	762
QBZ62602.1|GH55	3.80e-309	13	780	10	768
VBB79880.1|GH55	6.69e-305	19	780	14	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.25e-236	23	782	4	757	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	6.62e-201	25	778	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	1.17e-233	19	775	42	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	3.20e-209	20	778	38	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.63e-53	24	752	36	725	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999752	CS pos: 23-24. Pr: 0.9767

TMHMM  Annotations     

Start	End
7	26