CAZyme Information: SPBR_05607-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_05607-t41_1-p1
• CAZy Family: GH5
• CAZyme Description: long-chain fatty alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		87262.59	6.8429

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000004:1170273-1173010(+)

Full Sequence      

MTKAKTQAKTQANAQTAPNTPILAPPPTGDWWDETQWSVLVSLLDAVLAPVVAKGDARIE
QQRANKAAPTDGLQFNRATFKQLPKAELDKAIAGARAGVLSPPEAANVTDYLADRASDNP
KFLMGVRRTLSGVSPGTRKELGQLLTLLSGRAGALALTGYCVPVQKQPIHIREKILQNWS
NSWLPIIRIAARSFQALAQTSWLISSPMFRQITGFRDIPPNWKAGPGFDYNFLQFGKDDS
ANGKLETIETDVVIVGSGCGGAVSAKILASAGHRVVVVEKGYHYPQTQLPMPQNEGARLL
FENNGVLASTDPGINVAAGACWGGGGTINWSVSLRTPDRVRQEWAPKDQPGMSFLTSPEF
DASMDRVCDFMGVNSVIEDTPATATTDEVAKVDDEQSHRGRVILDSAVKLGFKADTLLQN
SKGGKPHDDGYCHLGCATAEKQGTSVSWLPAAANAGAQFIEGFHVERVLFEGDDGTAEGA
ATKSIPHSTSASGAKAIGVVGTWTSRDANGGVAGDERTKTRVVIKARKVVVSAGSLWSPV
VLKNSGLENPQIGKNLHLHPCNFVTAFFDEETRPMDKGIITSICTSFEDLDGEYHGPRLE
STCMVPYAIMSNMPWVNSLDFKLAAMRYPHMDGFIALTRDRDSGRVFPDPTTGQPVVDYH
PSALDREHGVEGVIGIARLCYAAGANEIRAFVAHTKPFIRANKGQSDNTKDDPVFEAWLK
DVRKAALSSSPLWGGWNVATPFISAHQMGTCRMGDDEGKASVVNPRGQVWGTRDLYVADA
SVFPSASGANPMVTTMSFADHIANGLAKELSGN

Enzyme Prediction     

No EC number prediction in SPBR_05607-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	245	805	2.6e-62	0.968978102189781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	3.82e-44	327	561	32	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.76e-34	251	804	9	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.76e-27	629	802	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	7.05e-09	746	803	473	528	choline dehydrogenase; Validated
274888	Rv0697	6.26e-08	250	803	1	483	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.62e-177	14	811	7	735
QRD90948.1|AA3_1|AA8	7.22e-10	251	803	305	851
BAE61169.1|AA3_1|AA8	2.72e-09	251	803	255	783
QMW43910.1|AA3_1|AA8	3.70e-09	251	803	309	837
QMW31885.1|AA3_1|AA8	3.70e-09	251	803	309	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	1.33e-11	251	806	7	527	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	1.76e-11	251	806	7	527	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	1.23e-10	251	806	7	527	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]
7DVE_A	6.44e-07	508	813	247	511	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
4QI7_A	5.36e-06	744	803	698	760	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.02e-79	135	810	90	746	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	8.53e-75	144	804	95	738	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	4.05e-70	144	808	103	750	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2
sp|O65709|FAO4A_ARATH	2.06e-68	145	799	64	711	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	1.04e-67	144	811	90	741	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000051

TMHMM  Annotations     

There is no transmembrane helices in SPBR_05607-t41_1-p1.