CAZyme Information: SPBR_04990-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04990-t41_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		49059.23	8.9235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000010:998999-1000409(+)

Full Sequence      

MPSLWGYIRGMVSPARYELVDNDKDRHDHDRPSWSSPSLSSLSSLSSSSSHSSSSSHTAA
WPDSPSQTPRHRNILSLLARRLRRSTTTLLLIDLLIIVVLLVAFEPLITLLRRNKEFFGP
RVVLSGPSSVDAWDPAGVTAAKNALGVPLPPPPPPPPAAKRNAIPRILHQTTATDVVPEK
WRASQQSCKDAYKGFEYKLWTDASARAFLAEEYPWFVDVWDNYVFPIQRADAIRYFVLYH
YGGIYLDMDTWCNASFPLERIEATPDDTSDAAQHRALFKSTLPTGITNDFMIASARHPAY
ASAIAQLPLYNALTHFWARWQPYAVIMISAGPMFLTMVVKDYLQTPPYALHARTIGVING
TELNPFITDLESATWHQGDAKALMWIGTRPWTWFGMGAIGLIIGLFIVNRLLTWCYGCAR
GSRSSLSSTEGGLLKLSKIV

Enzyme Prediction     

No EC number prediction in SPBR_04990-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	180	256	1.1e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.60e-42	163	394	81	298	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.53e-21	178	257	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS99794.1|GT32	2.43e-124	103	427	62	363
UKZ78464.1|GT32	1.29e-123	103	427	61	361
UKZ96119.1|GT32	2.34e-122	103	412	57	339
UKZ69326.1|GT32	3.67e-120	103	412	52	334
UPK95791.1|GT32	6.95e-114	12	412	12	362

PDB Hits     

SPBR_04990-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	8.97e-46	160	420	51	294	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.63e-42	164	414	62	295	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	5.47e-42	163	380	56	259	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	8.26e-42	164	385	82	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.81e-36	164	386	64	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000000

TMHMM  Annotations     

Start	End
89	111
391	413