CAZyme Information: SPBR_04879-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04879-t41_1-p1
• CAZy Family: GH37
• CAZyme Description: glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		63379.85	6.3262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000010:55196-56932(-)

Full Sequence      

MPSNGDHFDFVVVGGGTAGNVVAGRLAENPKAKILVIEAGIGKPEDVAQITTPGKAMTLR
GSEYDWAYKTTIVKRDDYERIEKPNTRGKALGGSSSLNYFTWVPGSKGTFDLWEAYGGKD
WTWDPLLPYLRKSATYHDDPKLYDTGLKKLGAGGPLHISHAELLPETEAFRKAIQSAWKS
TGQPDTENIYDGNMIGLTHCVDTIYKGVRSNSVVFLRGKPNITILSETHSKKLVVDAASK
KVTGVTVIGKDGKDQTFYADREVIVAQGVFESPKLLMLSGIGPKDQLKQHGISVVVDSPN
VGQNLLDHPAVPFVLRVKDGYGLDDFLHPARPHVQATQQTYDQSHTGPLSSGDLEMVGFP
RIDSYLEKVPAYVEAKKKNGGVDPFCGQGQPHFELDFVSAFGSAFQWHYPVPKQGNYTSV
VVDLVRPVSKPGEVTLNSADPLAQPNICLNFFADEIDIVAMREGIRFSYDMLTKGDGFKD
IVVAEYPWEMPLDDDKAMHHAVLDRCQTAFHPCGTNRLSKDIQQGVVDNELRVHGVSGLR
VIDASIIPEIPDCRIQNSVYAIGEKGADLIKAAHKDLY

Enzyme Prediction     

No EC number prediction in SPBR_04879-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	572	1.3e-150	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.72e-94	7	575	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.43e-87	7	571	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.09e-38	427	565	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.55e-25	87	310	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.01e-25	3	563	49	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02484.1|AA3_2	0.0	1	578	1	578
BCR85434.1|AA3_2	9.87e-318	1	578	1	578
UDD59638.1|AA3_2	8.90e-308	1	578	1	578
QMW42855.1|AA3_2	7.28e-307	1	578	1	578
QYT04257.1|AA3_2	1.44e-305	1	578	1	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.42e-308	3	578	2	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.93e-308	3	578	2	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.98e-307	3	578	2	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	2.75e-73	8	572	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.50e-72	8	572	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	9.88e-69	1	573	1	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|V5NDL4|PDH1_AGACM	2.36e-60	1	574	31	594	Pyranose dehydrogenase OS=Agaricus campestris OX=56157 GN=pdh1 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	9.62e-60	1	574	35	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.63e-60	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.63e-60	4	570	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000007

TMHMM  Annotations     

There is no transmembrane helices in SPBR_04879-t41_1-p1.