CAZyme Information: SPBR_04877-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04877-t41_1-p1
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	AWTV01000010|CGC10	61245.84	5.6001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000010:977539-979281(+)

Full Sequence      

MVNLSRVVRALGLASVFFLRVAADSQGSSLWDPPVDNEANVYARVIELQHAADHKVNGRL
LATWEHWYTTGPDTAVGNGTAGGFIIRASDDGSDSWATLTTVEDTASGPQQPLSLFWQPF
LFEFPVALGKYAAGTLLLVGNLVPQDKSTTNFYTWRSTDHGTTWKAVGHRPWQTGGPPSA
GIWEPFLYLDKHNRLVAVFSDERQNTAHSQMLVHVVSTDGGDSWGDVVVDVASDAQSDRP
GMATVARLPSGQYAMSYEVCGRPGCPVHVKTGDGTEWRAADIGSPVVSDHMYAGSSPYMI
WDPSTEQLVLSSHAIWDDATDTQAPPTRRAVFTNSDKNGAGAWSWSPAPWAASNASAACN
ANYSPHLLPLQGGTIRYTTPSSEGASGLCSERTGAAPVGVLPYRADFAAHGQLGWFDLGG
SWSVDGDAYSVGSVGNIDARAVTGSSGWTDYTVAADAMIVGSSGVVGLNARVTSPWNGLN
AFKGYTAAINSFTGNLTLSREAHAMVVLSSVAHPGGVVGNTWYHLSLTVHGHELTASVSS
ATGKTTTTVTAVDNSFPQGMAGLLVNDGAGSFSNVHINKV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	40	347	2.5e-68	0.9478827361563518
CBM66	415	575	8.7e-20	0.9612903225806452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.80e-05	54	252	84	262	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.09e-04	57	258	155	323	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
214740	VPS10	0.004	90	244	302	451	VPS10 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACQ79152.1|CBM66|GH93	2.10e-145	40	577	46	579
BDI28695.1|CBM0|GH93	1.13e-131	17	579	23	576
AQA09533.1|CBM66|GH93	3.78e-122	19	579	8	581
CDR01744.1|CBM66|GH93	2.98e-121	19	577	8	577
QPI53907.1|CBM66|GH93	2.98e-121	19	579	8	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5N_A	2.10e-37	30	375	16	344	Chain A, Alpha-l-arabinofuranosidase [Fusarium graminearum]
2YDT_A	2.10e-37	30	375	16	344	Chain A, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],5M1Z_A Chain A, Exo-1,5-alpha-L-arabinofuranobiosidase [Fusarium graminearum]
3A71_A	4.24e-37	57	303	33	274	High resolution structure of Penicillium chrysogenum alpha-L-arabinanase [Penicillium chrysogenum],3A72_A High resolution structure of Penicillium chrysogenum alpha-L-arabinanase complexed with arabinobiose [Penicillium chrysogenum]
2W5O_A	1.41e-36	30	375	16	344	Chain A, ALPHA-L-ARABINOFURANOSIDASE [Fusarium graminearum]
2YDP_A	1.41e-36	30	375	16	344	Chain A, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_B Chain B, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_C Chain C, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum]

Swiss-Prot Hits     

SPBR_04877-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006732	0.993240	CS pos: 23-24. Pr: 0.9602

TMHMM  Annotations     

There is no transmembrane helices in SPBR_04877-t41_1-p1.