CAZyme Information: SPBR_04729-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04729-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: endo-1,3-beta-glucanase Engl1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
764	AWTV01000010|CGC11	83017.46	6.5324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000010:744505-746799(-)

Full Sequence      

MDLFPPVPAASSASGLPAAISSRPDHPLKPVGISDAVRRSTGPLQSNKFYTNFMLHNQDL
PTYLLPYSVSWTNGRGPTNCWGLTVSYATPDQRVFGPTTGPCGHQGPPASYFYSPPIQPS
LVLDAAELNHQTALTLDDATDMFVLVSLRPGGPAAPPAVQFPLVQGQGFITALYHGARPI
LRTGMAILSVWDPYNGQGRDGGPLKPGMQRWVLKMNDGSTWLVYARARPGAPPLAFRQTA
DGALEGKGGFYGSVHVARVLHPEQGWAAYDQAAGVFAVGVHLSGHTENGGAVGQYSFAFR
KVDVTGDGAFLAHSPLLMFALPHHLASFDERTRAAVQPHIAMETPVKGTARAVLADAWTM
VEPSLPANMGFLPWDGHTKQAGRSTLSDAARRTIAQVARQELGQDMDAQSNLESAYFAGK
ALAKFALIVLCAHRLLGDEVKDAAADGLARLKAAFARFADNRQKHPLVYEATWGGVVSTA
AYTTGDAMADFGNSYYNDHHFHYGYFVFAGAVLAHLDPSWLQNRANAEYVDLLVRDYANP
SRQDAQFPVFRSFDWYHGHSWASGVFPSMDGKNQESSSEDAMAVYAIKMWGHVKGDAAME
QRGNLMLSVLARSLQTYYYYAAASSSEMPAPFVGNQVGGIVFENKIDHTTFFGGDPELIH
GIHMLPLLPCSPFCRPPAYVLQEWNDTFSNGRADKAQGGWRGVLYANLGTADPHAAFDYF
SKPGFADDMLDQGASRTWYLCYAAGEYTWTTDPFYPILSMSCDS

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	35	742	8.6e-198	0.9823151125401929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	7	745	54	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	385	740	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.21e-126	26	375	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64126.1|GH81	7.83e-246	12	744	175	870
AEO58881.1|GH81	4.12e-234	12	744	110	835
QSZ30780.1|GH81	1.15e-232	2	745	54	757
APA08036.1|GH81	1.27e-223	2	745	182	885
CAP66697.1|GH81	1.12e-222	17	744	264	955

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.51e-78	2	744	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.37e-78	2	744	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.38e-75	2	744	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.58e-34	401	738	326	652	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.58e-23	416	708	361	641	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	4.41e-203	2	748	192	904	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.10e-147	26	745	21	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.70e-146	17	759	57	749	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	4.34e-123	17	743	87	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.44e-121	17	745	437	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPBR_04729-t41_1-p1.