CAZyme Information: SPBR_04660-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04660-t41_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		96428.57	6.5705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000010:3058303-3061132(-)

Full Sequence      

MSVQHLKLSSHSGFEADATVTDDGRVDIAIDETDPGKLAALLVSKPLPASSSSSPADAGG
TSDPKLARLNIVIQVVGSRGDVQPFVALGHVLRRTYGHRVRLVTHSVFKEFVEAPERDGD
GDSGRLEFFDIGGGDPAELMSFMVQNGKTGQKDNDDGGGGQNHGDDGDNGDDDKDGGGGG
LIPPMESYTNGEIAGRRRFIEAVLHGCWRSMADDQGNASDGKVNNNGGSEHGAKDVPFVA
DAIIANPPSFAHIHIAESLGVPLHIMFTMPWTPTRSFPHPLANLKCISSASSFPSTDVSS
SVYGFASFLSYTIVECLTWQGLGDIINRFRSRNLGLEPLSPLLAVAPFHQGGLMGRLHVP
TTYCWSPSLLPKPPDWGAEITVAGYFFSAATSGGGYTPQPELAAFLAAGKPPIYIGFGSI
VVDDPVGLTKTVVDAVGRLKGARAIVSKGWGGLGEGDAYKGKSKDIFFLESDCPHEWLFP
RMACVVHHGGAGTTAAGLRFGVPSVVVPFFGDQPFWGSLVAQAGAGPDPVPFSRLTAERL
AAAIELALRPTTKTKAAALGDKIRDDKDGGGAVIGAQSFHKHLSRPRIHCQILPDRLAVW
QYRNKTKTTTVRLSALAAAILVHENKLAYSDLALFRAQEYHIHTGDQPWEPITGAGSAIL
GDLSSIAMAVADFPQELFRKAKKANDDGGDKGAGTDGGATTVKVDTPSATVTLDTAMQAG
QSISRIVSTGLQTPLHFCLGLARGFHNAPRLYHDDTVRALPGVGTAGDDGGRGGAEPAVD
GLGGGIRAASKAFGLGLYDGVTGLVTQPLQGAEQSGGKGFVKGFAKGIGGVVFKPAAGAW
SVPAYTMQGVQAEVQKLTGGVGPGVGPSKKEMQARRMAARKRQSEAEWKEASVGDNLGAE
SQAVLERWTKAEAGGDDRLD

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	329	567	3.1e-47	0.5261780104712042

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.01e-61	69	582	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.55e-31	71	577	4	389	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.30e-12	71	278	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	3.45e-08	409	585	224	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	5.25e-06	785	851	2344	2410	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60461.1|GT1	1.68e-233	10	857	52	899
QYS96614.1|GT1	3.36e-225	10	857	57	889
UQC88278.1|GT1	6.93e-225	10	855	70	949
AEO66120.1|GT1	2.20e-224	10	857	50	916
CDP23023.1|GT1	3.18e-224	59	917	59	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.92e-53	76	576	27	434	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.95e-53	76	576	47	454	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	3.52e-29	323	587	150	385	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.37e-28	255	587	112	402	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	6.07e-23	323	566	167	386	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	7.47e-103	66	583	153	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.06e-99	69	583	193	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q54IL5|UGT52_DICDI	1.36e-60	69	555	1164	1584	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q6C8M8|ATG26_YARLI	2.78e-60	67	587	993	1417	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q8NJS1|ATG26_LEPMC	2.08e-57	69	587	957	1378	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPBR_04660-t41_1-p1.