CAZyme Information: SPBR_04093-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_04093-t41_1-p1
• CAZy Family: GH2
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	AWTV01000005|CGC5	96064.25	6.2785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000005:1444858-1447524(-)

Full Sequence      

MPSSRVSERLSVLLCVLLWLAGLHSVAAHAVSRDTPSEGDPATAAARHQVRQRLSLNKDW
RFSRFTSNPDSLSYATLKPWMLASSTKFTPSKAQPPVVPSTTPAAINAKYAQAGFDDSAW
EAVNVPHDWAIKGPFGAPGVSGGMGRLPSNGVGWYRRNVTLEAADKGKSVFLDIDGAMSY
AAVWLNGHLVGGWPYGYASFRLDLTPYVVAGGDNTLAIRLDNALDNSRWYPGAGIYRNIW
LVKVDPVHVDQFGTFVTMPAVSADSATAHLVVEVENTATESRQVDVHTEVHVFDAATRSA
AKDVVVAFAKTALTVPAGSTASTNSSATIPSPLLWGPPPDQKPHLYVAVTTLSVNGSVVD
TYETRFGVRSITYDANNGLFVNGKKVRVQGTNNHHDQGALGAAFHVRAAERQLEMLQDFG
CNALRTSHNPPAPELVDLADEKGFLVFDEIFDSWAGAKTTNDFHLIFSDWHEADLRAFVR
RDRNHPSVIVWSYGNEIGEQKSDSSRRVAQELHDMIHSEDPTRPTTASMNSAGAGSAFAD
VMDVESLNYQGEGMGTSNFSSFPSFHKAYPNKMIWTSESASTLSSRGTYIFPVTSAYSAI
VGSNSGGDDANMYVSAYDLYAPSWASSPDKVFAMQDEHPYVAGEFVWTGFDYIGEPTPYN
NARSSYFGIIDLAGFRKDRFYMYQARWRPGVPMAHILPHWTWPDRVGKVTPVHVFSSGDE
AELFVNGQSAGRLNKAEYTYRFRWDNITYAAGDLRVVTYKNGKEWAVDAVKTVGAATHLN
LVADRTTIAGDGLDLSYLTASVVDADGNTVPQANNAITFTVAGAGELVATDNGDPTDMTA
FPSATRKAFSGLTLAIVRAKGSDDAGKNVTVSASAPGLKGAKVTLILS

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	44	754	2.3e-121	0.6821808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.15e-67	51	705	10	618	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	1.44e-48	150	551	62	474	beta-D-glucuronidase; Provisional
408349	Glyco_hydro2_C5	1.69e-42	779	884	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236673	ebgA	2.40e-40	107	523	55	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	5.51e-35	23	524	25	484	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59435.1|GH2	0.0	51	885	44	878
QRD01710.1|GH2	0.0	31	885	17	873
QRD03755.1|GH2	0.0	34	885	25	878
AEO71826.1|GH2	0.0	43	888	16	864
CAE7211356.1|GH2	0.0	51	885	66	902

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.52e-185	115	885	49	818	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	7.20e-171	115	885	28	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.11e-168	114	878	33	798	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	3.08e-143	115	885	31	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	6.45e-143	115	885	54	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	1.92e-170	111	879	62	840	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	2.83e-101	110	859	65	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KN75|PLH17_FORAG	2.64e-57	107	885	41	793	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|T2KPJ7|PLH8_FORAG	5.99e-50	107	848	66	794	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	7.56e-43	152	828	57	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999784	CS pos: 28-29. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in SPBR_04093-t41_1-p1.