CAZyme Information: SPBR_03723-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_03723-t41_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		45874.38	4.3561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000003:331942-333425(-)

Full Sequence      

MHSVLSLTALAAVLPQALAAYQGFNYGSTFTDGSAKAQSDFENEFKTAAGLDGTNGAFTS
ARLYTMIQGGTANDVISAIPAAISTKTSLLLGLWASGGDAGFANELAALKAAISTYGESL
GPLVAGISVGSEDLYRITPTGIENESGVGAGPDVLTSYIKQVREAIANTPLSGASIGHVD
TWTAWVNGSNTAVIDAIDWLGVDAYPYFQNTMANGIAQGPGLLNDAISETTGVAQGKPVW
ITETGWPVSGKTENEAVASTENAKTFWDEAGCPRFGSVNVWWYTLQDAAPSTPNPSFGVI
GSTLTTTPLYDLSCSGSSSNSTSTSSTAAAAASSSAAKSSTPVKNSSSAAASHAASSPGV
VIGGGGAGGSSVHVQTTLPSTTAVNTATSTPSAARTSATGSGSGSGSGSGSGNGTSPSTG
RVGPTTTSSGGATTTSGPVVVTNGAVAMSGSIGAGFAAVMAAILAL

Enzyme Prediction     

No EC number prediction in SPBR_03723-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.76e-28	23	272	47	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.51e-08	104	312	79	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89650.1|GH17	1.28e-150	10	318	7	316
CEI68891.1|GH17	9.92e-147	1	318	1	316
EAL86311.1|GH17	1.06e-145	7	318	6	314
QPC78631.1|GH17	1.13e-143	1	318	1	316
UKZ85392.1|GH17	6.41e-143	1	315	1	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.00e-15	21	308	37	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	1.88e-146	7	318	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	2.15e-146	7	318	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.23e-145	7	318	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	2.97e-139	7	318	6	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	2.41e-133	7	318	6	315	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999765	CS pos: 19-20. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in SPBR_03723-t41_1-p1.