CAZyme Information: SPBR_03111-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_03111-t41_1-p1
• CAZy Family: GH154
• CAZyme Description: spherulin 4-like cell surface

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	AWTV01000006|CGC6	31976.55	4.2052

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:366436-367341(-)

Full Sequence      

MVAYTRALAGAVGLLVPLYEYPTGTTATADWTALIAAIDAHPQLPFYVVVNDANGPPYSP
NPPASIPDWAQWIDALNARSNAKTIGYIYTSQSTRAYSDLTAAVDQYASWTTSAGFTTNA
SRYDIHIDGIFFDEIDTVPAKLTANTQLTTYAKTAFAGRGGPVVLNPGTLVQAGSESLFD
LADSIVQIETCYTNTTGATDPGGIVRCQPDRYAPFTPALATTVGDAARSAKSSIVVHDFY
ETWSPFAPASLSSLQTDIAAVIQQGVHSFYFTVYGYTTDFTASPASITQVADYAAQLQGL
A

Enzyme Prediction     

No EC number prediction in SPBR_03111-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	14	240	3.3e-37	0.810126582278481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	2.04e-37	19	272	1	217	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY60853.1|GH135	2.62e-84	3	301	9	306
UQC82105.1|GH135	3.66e-80	9	300	15	305
GAA95568.1|GH135	6.36e-23	14	272	20	234
QQK42578.1|GH135	1.34e-21	1	194	7	188
QLI69009.1|GH135	3.64e-21	7	295	17	271

PDB Hits     

SPBR_03111-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPBR_03111-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPBR_03111-t41_1-p1.