CAZyme Information: SPBR_02939-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02939-t41_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	AWTV01000006|CGC28	30711.55	4.7577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:2283807-2284967(-)

Full Sequence      

MMYPLSIAFLALPLLASAQKCTIQFDGRVPSTFTAASFDTNNNLFNPSNVFGQGLKFSQL
IQLPAVTGSLFDVNTVPAEVTISDKSIFAPSADNVQTGFRRAELLPASNSGTDPSTQGIK
TLHFSVMQDAQRPLNLTHEYQLVFLESNDFSTNQLVLKAGTVLGQAGNVDPNTLQLFGNV
NSNPPQVLFSTPFTPGVFHNFAVTLDFNKLTSQVFFSTGTTALKSVTQALANDVSGQGQF
HFGVLKKPVNPGADIVHSGTQEPGINEGVIFGGIFEEDSSTGCISLSP

Enzyme Prediction     

No EC number prediction in SPBR_02939-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	25	283	4.2e-77	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	3.79e-89	23	282	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC91294.1|GH131	5.32e-127	20	288	98	365
QBZ65172.1|GH131	3.07e-120	19	287	23	293
VBB76803.1|GH131	5.41e-118	17	288	18	276
UQC90347.1|GH131	4.63e-114	1	288	1	285
AEO64872.1|GH131	4.67e-113	10	287	13	277

PDB Hits     

SPBR_02939-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPBR_02939-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999739	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02939-t41_1-p1.