CAZyme Information: SPBR_02935-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02935-t41_1-p1
• CAZy Family: GH132
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		44286.56	7.6798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:2050262-2051434(+)

Full Sequence      

MLSTGPLPRRLRSRFGLLVTGFLVVFVFLSRHILYTAWTLAYMPMVWSRDAPAFVISQAL
DNFDITFADYNASQTEAGFDYPDRVPPVMHHVVLGSRPALPAWTETRQSCLDFHQGWETH
YWTDETAAAFVADKFPEVKATWDSYPFLIQKVDALRYMVLYEYGGAVLDMDLRCKRALGP
LRRFGFVAIEAMPVGFSSGFMMAERHNPLVGAIVDSLKAYNHRWLGLPYPTVMFSTGCHF
ASTIHALQANRSDYKVLRGPDDNRDMHKLNGKVSTPIFDHLGSSAWHSFDGAAIIMLRNA
LPYLLPVLLVVGVASIVFAKRRRLRLLQRPVPHMRELLRHQHDEQQHDKYVSGSESSSTD
GDDSDDEKVFRDFSPRTASRDYPSDGSRHV

Enzyme Prediction     

No EC number prediction in SPBR_02935-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	103	181	1.9e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.22e-17	79	286	74	279	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.47e-10	103	181	4	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68738.1|GT32	1.24e-121	12	322	12	324
UNI15446.1|GT32	1.48e-121	23	322	28	319
QLI73314.1|GT32	2.49e-118	23	326	25	327
QYT03157.1|GT32	2.55e-118	3	322	10	322
ANH56537.1|GT32	9.06e-118	27	324	30	321

PDB Hits     

SPBR_02935-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	9.10e-27	82	299	52	264	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.19e-26	55	300	36	276	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	1.50e-25	103	290	74	258	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.74e-25	79	299	55	272	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.29e-25	83	305	79	300	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000011

TMHMM  Annotations     

Start	End
13	35
300	319