CAZyme Information: SPBR_02905-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02905-t41_1-p1
• CAZy Family: GH131
• CAZyme Description: ligninase H2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	AWTV01000006|CGC20	38826.65	5.4921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:1320871-1322087(-)

Full Sequence      

MRSLTTSALQLLAAGHVVTAYPGMGRLLADLQKMQRHESQLGARAPAGFLGSTTILGDLA
NLPDSALTPVGANIKAVLSGNGGQPLGDGIPEYDAPGPLGSDACTADACCVHKYAMLDMY
SLFSDPASGGCSPLARGAIRLGFHDAAAWDTGAGYGGGGADGSIVLSPAELARPVNAGLQ
AIANQTWAWYERYHQHGASMADLIQLGAMTAVTACPGGPRMRFYVGRADNTNAAPDNMLP
DPTSGADTIAALFAAKTISPGGLAALIGAHTVSQQFSMAPAQAGAGQDPTPGVWDNLYYS
TTLAATAPAGVYRFPSDVALAQSAGAASSFQFFGTQAGRSTWQTAFASEYLRMSLLGVYN
INSMTDCTHVLPQSTFQG

Enzyme Prediction     

No EC number prediction in SPBR_02905-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	129	357	7.7e-48	0.9294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	3.08e-74	98	375	4	291	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	1.98e-19	134	354	17	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	8.30e-15	137	272	18	151	Peroxidase.
178467	PLN02879	2.08e-13	127	320	29	211	L-ascorbate peroxidase
173825	ascorbate_peroxidase	2.37e-11	127	358	25	250	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO59029.1|AA2	6.55e-95	20	374	14	361
CCF45286.1|AA2	3.85e-92	3	378	4	373
VBB71993.1|AA2	1.47e-88	55	377	46	363
QRD06638.1|AA2	9.85e-87	1	372	1	359
CDP22930.1|AA2	2.74e-86	55	377	105	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LY8_A	4.51e-30	96	374	3	299	Chain A, Peroxidase [Coprinopsis cinerea],1LY8_B Chain B, Peroxidase [Coprinopsis cinerea]
5FNB_A	1.29e-28	105	372	9	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]
1LYK_A	1.10e-27	96	374	3	299	Chain A, Peroxidase [Coprinopsis cinerea],1LYK_B Chain B, Peroxidase [Coprinopsis cinerea]
2VKA_A	1.34e-27	105	372	9	283	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
1LY9_A	1.52e-27	96	374	3	299	Chain A, Peroxidase [Coprinopsis cinerea],1LY9_B Chain B, Peroxidase [Coprinopsis cinerea],1LYC_A Chain A, Peroxidase [Coprinopsis cinerea],1LYC_B Chain B, Peroxidase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P28313|PER_ARTRA	5.73e-27	72	374	7	320	Peroxidase OS=Arthromyces ramosus OX=5451 PE=1 SV=3
sp|P28314|PER_COPCI	7.78e-27	96	374	23	319	Peroxidase OS=Coprinopsis cinerea OX=5346 GN=CIP1 PE=1 SV=2
sp|A8NK72|PER_COPC7	2.03e-26	96	374	23	319	Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) OX=240176 GN=CIP1 PE=3 SV=1
sp|O94753|VPL2_PLEER	3.73e-26	86	372	13	313	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|Q9UR19|VPL1_PLEER	7.07e-26	108	372	43	313	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.967019	0.033004

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02905-t41_1-p1.