CAZyme Information: SPBR_02804-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02804-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		49631.22	5.7515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:1405207-1406604(-)

Full Sequence      

MARPILLFCCHPLTGHITPVLRIAAGLHQQLGWRVSFLSAAFFRARIEAAGLQFLPLVGD
VADLDDDSLFDRKKGGVDGLSPEQAAALPQSVTDNRHQALCALPGEWASLQAAVDALIHE
NPGSRILVVTEAFFYGAMPLKLGLSLPPAVLRRSVCLSITAPAIRSVDHPPYGYPDSLEK
TPDRPARLAALWNEWITARAAPLSALWREKLKEAGLSVDERVKNIVFMAGANYVCHDAIA
QVGVPSFELPRSDMPAGFHIVGVVPPVVLAAPPPFPWWGELVSNQALPLNDRKKVVVVAQ
GTVETEPTELIVPTIRLLADRTDVLTIAILGVRGASLSESSGPLPVNCRVADYLSYDAVL
PYAALWVHNGGYGATMHGIIHGVPQVLAGETQDKPESGKRVQYSGLGINLATAHPTPEAL
GAALDAVLSEPKYAATAQAMQAEAAAMDCVGNVEKVILEEIQACT

Enzyme Prediction     

No EC number prediction in SPBR_02804-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	152	459	1.4e-29	0.6858638743455497

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.79e-24	7	433	4	378	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.66e-24	5	464	4	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94024.1|GT1	3.44e-70	3	458	25	459
CAK39187.1|GT1	1.11e-68	2	460	15	455
CCD52882.1|GT1	1.52e-67	3	459	6	445
ATZ51905.1|GT1	2.99e-67	3	459	6	445
QPH11511.1|GT1	1.41e-65	3	459	6	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	4.04e-08	342	434	275	367	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	4.07e-08	342	434	278	370	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.41e-66	12	459	27	456	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.68e-64	3	443	7	417	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	2.09e-51	3	443	5	413	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	3.46e-33	12	450	11	410	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|Q9XC67|TYLCV_STRFR	4.44e-08	290	432	289	428	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000042

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02804-t41_1-p1.