CAZyme Information: SPBR_02694-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02694-t41_1-p1
• CAZy Family: GH125|GH125
• CAZyme Description: chitooligosaccharide oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	AWTV01000006|CGC16	55196.04	6.3542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:134101-135722(+)

Full Sequence      

MTMGNANFVVAVLWLLQLLGHAHLGSAAALNVNAEVESCLTKAGVPFDAPGTADWSQDAA
PFNLRLNYTPAAIAVPTTVKHIQDAVSCAAKLGVKANPKCGGHSYASFGLGGEDGHLVIE
LDRMDSVILDNSTGIATVQGGARLGHVAAELYAQGKRGFSHGTCPGVGIGGHALHGGFGV
SSHTQALALDFVVGIKVVLSNSTVVDCSETENPDLFWALRGAGASYGVVAEFKFRTFVVP
EVVTFYSAAINWKQEKAVDGLKAFQAFAESGMPSELNLRMFITKDFANFEGLYWGNKTGL
QAVLAPLLNQTGAKLVLAQQGTWLDQLEHFGNGMDLNQTHPYNMHETFYSSSLYTNKLSD
DQVGAFVNYWYGTGKAIKRDWYAQIDVHGGKNSAVGRVTPNATSYAHRDFLLMTNFYDRV
DTGAYPADGFSFLDNFTSNITGSLEPNEWGRYVNYPDPRLSQAAAQKSYWSTHLDRLQQL
KAGVDPHNLFDYPQGILPATAAAPTSAPAKAPSA

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	59	496	3.2e-86	0.9912663755458515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.67e-25	70	208	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	3.16e-25	67	490	29	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.07e-09	452	496	2	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
273751	FAD_lactone_ox	2.43e-07	76	253	21	201	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB75481.1|AA7	2.60e-221	18	500	10	494
CAP73004.1|AA7	3.69e-221	18	500	10	494
CDP25404.1|AA7	3.69e-221	18	500	10	494
AEO63154.1|AA7	3.13e-218	18	499	10	492
QBZ54840.1|AA7	7.09e-216	27	499	20	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.95e-164	34	499	25	495	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	2.44e-148	36	498	27	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
1ZR6_A	1.22e-140	36	490	9	470	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	2.76e-139	36	490	9	470	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
3RJ8_A	3.82e-137	36	498	3	471	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QG48|XYLO_MYCTT	1.00e-163	34	499	25	495	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.25e-147	36	498	27	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	2.75e-140	22	490	14	489	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	8.81e-138	26	498	15	493	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|P9WEY2|DPMAF_METAN	2.33e-130	38	496	31	489	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999747	CS pos: 27-28. Pr: 0.9715

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02694-t41_1-p1.