CAZyme Information: SPBR_02608-t41_1-p1

Basic Information

• Species: Sporothrix brasiliensis
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix brasiliensis
• CAZyme ID: SPBR_02608-t41_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		60598.41	6.1952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sbrasiliensis5110	9231	1398154	140	9091

• Gene Location: location=AWTV01000006:964341-966123(+)

Full Sequence      

MASRFLASIALALLVQQSSGQIDQSVFELNACPDYVLYSTYPHRPLTKGPLALPFQRPHK
NCRTFHSDAIESVISDVTSRMKDVDMARLFENTFPSTTDTTVKFHTNGTDGKVSEAVRAK
IKAASGGAYDDGKWEGAQSFVITGDIIAEWLRDSTNQLSPYQPLAKTDPAVYNLILGAIN
TQSEYVIESPYCNAFQPPPISGLRPSHNGQDDKVHPAFEPSFVFECKYELDSLAHFLALG
NDFHDHTGSTDYLNRRWYRALATVLRVLDQQSLSTFDPVTNHYRRNEYTFQRQTDTGTET
LNLAGIGNPLNNGTGLIRSAFRPSDDSTILGFFIPANAMMAVELKRTAAVLAKIKGKEAL
AKAVASWSQEITNGVWEHGVVKHREFGDVFAYEVDGYGSHIMMDDANYPSLLALPLMGFL
PASDPTYQNTRRMLLSKQSNPYYLKGRDFKGIGGPHIGLQNAWPMSLLIQAQTSDDDAEI
QECLNMVLKSAPLGLIHESVDVNYITSYTRSWFAWANGVFAETILDLAKRKPHLIFKAPA
EAYEI

Enzyme Prediction     

No EC number prediction in SPBR_02608-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	83	525	2e-162	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	83	525	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	3.07e-165	62	534	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC71621.1|GH125	3.48e-283	1	545	1	543
UNI20401.1|GH125	1.07e-282	31	545	38	545
AEO66735.1|GH125	5.22e-282	27	545	33	550
QPC60340.1|GH125	5.73e-282	1	545	1	543
UKZ64614.1|GH125	2.16e-281	32	545	36	541

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	5.15e-95	57	527	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.84e-91	57	527	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.40e-90	57	527	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	6.28e-77	68	526	10	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	1.10e-76	68	526	10	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	6.34e-181	31	537	26	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999735	CS pos: 20-21. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in SPBR_02608-t41_1-p1.